KEGG   Cynoglossus semilaevis (tongue sole): 103380409
Entry
103380409         CDS       T04866                                 

Definition
(RefSeq) mitogen-activated protein kinase 12
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem04010  MAPK signaling pathway
csem04068  FoxO signaling pathway
csem04114  Oocyte meiosis
csem04218  Cellular senescence
csem04261  Adrenergic signaling in cardiomyocytes
csem04370  VEGF signaling pathway
csem04620  Toll-like receptor signaling pathway
csem04621  NOD-like receptor signaling pathway
csem04622  RIG-I-like receptor signaling pathway
csem04625  C-type lectin receptor signaling pathway
csem04912  GnRH signaling pathway
csem04914  Progesterone-mediated oocyte maturation
csem05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:csem00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103380409
   04370 VEGF signaling pathway
    103380409
   04068 FoxO signaling pathway
    103380409
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    103380409
   04218 Cellular senescence
    103380409
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103380409
   04621 NOD-like receptor signaling pathway
    103380409
   04622 RIG-I-like receptor signaling pathway
    103380409
   04625 C-type lectin receptor signaling pathway
    103380409
  09152 Endocrine system
   04912 GnRH signaling pathway
    103380409
   04914 Progesterone-mediated oocyte maturation
    103380409
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103380409
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103380409
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:csem01001]
    103380409
Enzymes [BR:csem01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     103380409
Protein kinases [BR:csem01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   103380409
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr RIO1 Kdo APH Kinase-like FTA2
Other DBs
NCBI-GeneID: 103380409
NCBI-ProteinID: XP_008310585
UniProt: A0A3P8VQP9
LinkDB
Position
6
AA seq 361 aa
MTKRVRPGYCRQEVNKTTWEVPDRYRDLKQVGTGAYGTVCSALDSRTGAKVAIKKLYRPF
QSDLFAKRAYRELRLLKHMKHENVIGLVDVFTADLSLDRFQDFYLVMPFMGTDLGKLMKV
QRLSEEKIQYLVYQMLRGLKYIHSAGIIHRDLKPGNLAINQDCELKILDFGLARQADSEM
TGYVVTRWYRAPEVILSWMHYTQTVDIWSVGCIMAEMLQGKPLFKGSDHLDQLTEIMKVT
GTPTQEFILKLESEDAKSYIKGLPKVEKKELQKLFSTTNPQAVSVLERMLLLDPQSRATA
AEALSLPYFTDFRDPDEETEAQLYDHSLDNADMPLEQWKRHTFTEILTFKPVVPESKETS
L
NT seq 1086 nt   +upstreamnt  +downstreamnt
atgactaagcgagtcagacccggctattgtcgccaagaagtgaacaaaacgacatgggaa
gtaccggatcgatatcgggatctgaagcaggtgggcaccggggcttacgggacggtgtgc
tcagctctggactccagaaccggagccaaggtggccatcaagaagctgtaccgacctttc
cagtcggacctttttgcaaagcgtgcttacagggagctgaggcttctcaaacacatgaaa
catgagaatgtgatcggtctggtagatgtgttcacagctgacctctctctggacagattc
caggacttttatctggtaatgccatttatgggcacagatctggggaagctgatgaaagta
cagaggctgtcggaagaaaaaatacagtatttggtttatcagatgcttcggggtctgaag
tatattcactcagctggtataattcacagggacctcaaaccgggaaatcttgctatcaac
caagactgcgagctcaagattctggactttggtctggcacggcaggcagacagtgagatg
acggggtatgtggtgacccgatggtacagggctccagaggtcatcctcagctggatgcac
tacactcagactgttgacatttggtctgtgggctgcatcatggcggaaatgctgcaagga
aaacctcttttcaaaggcagtgaccacctagatcagctgactgagatcatgaaggtcaca
ggaacacctactcaggaatttatcttaaaactggagtctgaagatgccaaaagctacata
aaaggtcttccaaaggtggaaaagaaagaacttcagaaactgttttctacaactaatcct
caagctgtgtctgtgctggagcgcatgctgctgctcgacccacagagcagagcgacggcc
gcggaggctctcagtctgccgtacttcaccgacttcagagatccggatgaggagacggaa
gcacagttatacgaccactcgttagacaacgccgacatgcctctggaacagtggaaacgt
cacaccttcacagagatattgacattcaaaccagttgtgccagaatccaaggaaacctca
ttgtaa

KEGG   Cynoglossus semilaevis (tongue sole): 103382962
Entry
103382962         CDS       T04866                                 

Definition
(RefSeq) mitogen-activated protein kinase 11-like
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem04010  MAPK signaling pathway
csem04068  FoxO signaling pathway
csem04114  Oocyte meiosis
csem04218  Cellular senescence
csem04261  Adrenergic signaling in cardiomyocytes
csem04370  VEGF signaling pathway
csem04620  Toll-like receptor signaling pathway
csem04621  NOD-like receptor signaling pathway
csem04622  RIG-I-like receptor signaling pathway
csem04625  C-type lectin receptor signaling pathway
csem04912  GnRH signaling pathway
csem04914  Progesterone-mediated oocyte maturation
csem05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:csem00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103382962
   04370 VEGF signaling pathway
    103382962
   04068 FoxO signaling pathway
    103382962
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    103382962
   04218 Cellular senescence
    103382962
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103382962
   04621 NOD-like receptor signaling pathway
    103382962
   04622 RIG-I-like receptor signaling pathway
    103382962
   04625 C-type lectin receptor signaling pathway
    103382962
  09152 Endocrine system
   04912 GnRH signaling pathway
    103382962
   04914 Progesterone-mediated oocyte maturation
    103382962
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103382962
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103382962
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:csem01001]
    103382962
Enzymes [BR:csem01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     103382962
Protein kinases [BR:csem01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   103382962
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo RIO1 APH Kinase-like
Other DBs
NCBI-GeneID: 103382962
NCBI-ProteinID: XP_008314164
UniProt: A0A3P8WAL5
LinkDB
Position
8
AA seq 361 aa
MSARPGFYRQELNKTVWEVPERYQNLTPVGSGAYGSVCSAYDVVLRQKVAVKKLSRPFQS
LIHSRRSYRELRLLKHMKHENVIGLLDVFTPAAALEDFNELYLVTNLMGADLNNIVKFQR
LSDEHVQFLIYQLLRGLKYIHSAGLIHRDLKPSNVAVNEDCELRILDFGLARQTNDEMTG
YVATRWYRAPEIMLNWMHYNQNVDIWSVGCIMGELLKGKVLFPGTDYIDQLKRIMEVVGT
PTPDLLKKICSEHAQKYIQSLPFMPQQDLEKIFRGANPLAVDLLKRMLVLDCDGRISACE
ALSHPYFSQYHDPEDEPEAPPYDQTLESKDRSLEEWKELVFEEVNSFGAASSKTDSLQVE
Q
NT seq 1086 nt   +upstreamnt  +downstreamnt
atgtctgctagacccggattttaccgacaggagctcaacaagactgtgtgggaggtaccg
gagcggtaccagaacctgacgccggtgggatcgggagcctatggatcggtgtgctcggcc
tatgatgtggtcctgaggcagaaggttgcggtgaagaagctctccaggccgtttcagtct
ctgatccacagccgccgctcgtaccgggaactcaggctgctcaagcacatgaaacacgag
aatgtgatagggctgctggatgtcttcacacctgctgcagcgttggaggacttcaatgaa
ctctacctggtgaccaacctgatgggcgcagacctcaacaacatcgttaaatttcagagg
ctttccgacgaacacgtgcagttcctaatttatcagctgctccgtggcctgaagtacatc
cattcagctggactcatacacagagacctgaagcccagtaatgtggcagtaaatgaagac
tgtgagctgaggatcctggacttcggcctggcccggcagaccaacgatgagatgacgggc
tacgtggcgactcgttggtaccgggcgccggagatcatgctgaactggatgcactacaat
cagaacgttgatatttggtcggtggggtgcatcatgggagaactcctgaaggggaaggtc
ctcttccctggcactgactatatcgatcaactgaagagaatcatggaggtggttgggact
ccgacccccgacctgttaaagaagatctgctctgaacatgcacagaagtacatccagtct
ctgcccttcatgccccagcaggacctggagaagatcttcagaggagccaatcctctagcc
gttgaccttctaaagcggatgctggttctggactgcgacggcaggatctcggcctgcgag
gctctctctcacccgtacttctcccagtaccacgacccagaggatgagccggaggctccg
ccctacgaccagactctggagagcaaagaccgcagtctagaggagtggaaagagttggtg
tttgaggaggtgaacagcttcggtgcagccagcagtaagactgatagtcttcaggtggag
cagtaa

KEGG   Cynoglossus semilaevis (tongue sole): 103382963
Entry
103382963         CDS       T04866                                 

Definition
(RefSeq) mitogen-activated protein kinase 12-like
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem04010  MAPK signaling pathway
csem04068  FoxO signaling pathway
csem04114  Oocyte meiosis
csem04218  Cellular senescence
csem04261  Adrenergic signaling in cardiomyocytes
csem04370  VEGF signaling pathway
csem04620  Toll-like receptor signaling pathway
csem04621  NOD-like receptor signaling pathway
csem04622  RIG-I-like receptor signaling pathway
csem04625  C-type lectin receptor signaling pathway
csem04912  GnRH signaling pathway
csem04914  Progesterone-mediated oocyte maturation
csem05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:csem00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103382963
   04370 VEGF signaling pathway
    103382963
   04068 FoxO signaling pathway
    103382963
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    103382963
   04218 Cellular senescence
    103382963
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103382963
   04621 NOD-like receptor signaling pathway
    103382963
   04622 RIG-I-like receptor signaling pathway
    103382963
   04625 C-type lectin receptor signaling pathway
    103382963
  09152 Endocrine system
   04912 GnRH signaling pathway
    103382963
   04914 Progesterone-mediated oocyte maturation
    103382963
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103382963
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103382963
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:csem01001]
    103382963
Enzymes [BR:csem01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     103382963
Protein kinases [BR:csem01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   103382963
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr RIO1 Kdo APH Kinase-like
Other DBs
NCBI-GeneID: 103382963
NCBI-ProteinID: XP_008314165
UniProt: A0A3P8WII0
LinkDB
Position
8
AA seq 360 aa
MAVRSRTGFYRQEVNRTVWEVPERYRDLKQIGTGAYGTVCSAWDRRSATQVAIKKLHRPF
QTKLFAKRAYRELRLLKHMKHENVIGLLDVFTAEIALDRLRDFYLVMPFMGTDLGKLMKL
ERLTEDRVQFLVYQMMRGLKYIHSAGIIHRDLKPGNLAINPDCELKILDFGLARQADAEM
TGYVVTRWYRAPEVILNWMHYTQTVDIWSAGCIMAEMLLGKPLFKGNDHLDQLREIMKIT
GTPAADFVVKLQSQDAKNYIRSLPKVPKKDLHSIFSKASSNAVCVLEKMLLLDPEQRVSA
SEALELPFFSEFRDTDEETEALPYDQTIDNMDLQLDQWKRHTFTEILTFRPPKDPRETSL
NT seq 1083 nt   +upstreamnt  +downstreamnt
atggcggtgcgctcacggaccgggttttaccggcaggaggtcaacaggaccgtgtgggag
gttccggagcggtaccgggacttgaagcagatcgggacgggagcctatggaaccgtgtgc
tcagcctgggaccgacgttcagcgacgcaggtcgccatcaagaagctgcaccgaccattt
cagaccaaactcttcgccaaaagagcgtacagagagctgcggctgctcaaacacatgaag
cacgaaaatgtgattggactgctggacgttttcacagcggagatcgcactggaccggtta
cgtgacttttacctggtgatgccgtttatgggcactgacctcggcaagttgatgaagctg
gagcgcctgacggaggacagggtgcagttcctggtctatcagatgatgaggggcctgaag
tacatccactccgcagggatcattcacagggacctcaagcctggaaatttggccataaat
ccagactgcgagttaaagatccttgacttcggcctggcgaggcaggcggacgcagaaatg
accggctacgttgtgactcgctggtacagggcaccagaggtcatcctcaactggatgcac
tacactcagactgtggatatctggtccgcgggctgcatcatggccgagatgctgctggga
aaaccgctgttcaagggaaacgaccacctggaccagctgagagaaatcatgaagatcaca
ggaactccagcggccgactttgttgtgaagctacaaagccaagacgccaaaaactacatc
aggagtttacctaaagtgccgaaaaaggacttacactccattttctctaaagccagctcc
aacgcggtgtgtgtcctggagaagatgctgctcctggaccctgagcagagggtgagtgcc
tcggaggcgctggagctgccgttcttcagcgagttcagggacacggacgaggagacagag
gcgctgccgtacgaccagaccatcgacaacatggacctgcagctggaccagtggaaacgt
cacacgttcacagagatcctgaccttcaggccgcccaaagaccccagggagacgtcactt
taa

KEGG   Cynoglossus semilaevis (tongue sole): 103384606
Entry
103384606         CDS       T04866                                 

Definition
(RefSeq) mitogen-activated protein kinase 14A-like isoform X1
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem04010  MAPK signaling pathway
csem04068  FoxO signaling pathway
csem04114  Oocyte meiosis
csem04218  Cellular senescence
csem04261  Adrenergic signaling in cardiomyocytes
csem04370  VEGF signaling pathway
csem04620  Toll-like receptor signaling pathway
csem04621  NOD-like receptor signaling pathway
csem04622  RIG-I-like receptor signaling pathway
csem04625  C-type lectin receptor signaling pathway
csem04912  GnRH signaling pathway
csem04914  Progesterone-mediated oocyte maturation
csem05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:csem00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103384606
   04370 VEGF signaling pathway
    103384606
   04068 FoxO signaling pathway
    103384606
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    103384606
   04218 Cellular senescence
    103384606
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103384606
   04621 NOD-like receptor signaling pathway
    103384606
   04622 RIG-I-like receptor signaling pathway
    103384606
   04625 C-type lectin receptor signaling pathway
    103384606
  09152 Endocrine system
   04912 GnRH signaling pathway
    103384606
   04914 Progesterone-mediated oocyte maturation
    103384606
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103384606
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103384606
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:csem01001]
    103384606
Enzymes [BR:csem01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     103384606
Protein kinases [BR:csem01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   103384606
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo APH Kinase-like FTA2
Other DBs
NCBI-GeneID: 103384606
NCBI-ProteinID: XP_008316398
LinkDB
Position
10
AA seq 349 aa
MSQKERPVFYREEVNKAIWEVPERYKKLSPVGSGAYGSVCSSYDMKSGEKVAVKKLSRPF
QSIIHAKRTYRELRLLKHMKHENVISLLDVFTPATSLKEFNDVYLVTHLMGADLNNIVKC
QKLTDDHVQFLIYQILRGLKYIHSAGIIHRDLKPSNLAVNEDCELRILDFGLARHTDDEM
TGYVATRWYRAPEIVLNWMHYNMTVDIWSVGCIMAELLTGRTLFPGTDHINQLQQIMRLT
GTPPDSLISRMPSQEARNYVSSLPNMPKRNFAHVFIGANPQAVDLLEKMLVLDTDKRITA
AEALAHPYFAQYHDPDDEPEAEPYDQSFESRELEIDEWKRLTYEEVCSF
NT seq 1050 nt   +upstreamnt  +downstreamnt
atgtcgcagaaagaaagacccgtcttttatcgagaggaggtcaacaaggcaatatgggaa
gttccggagcggtacaagaagctatccccggtaggctcgggcgcctacggctcagtgtgt
tcatcatatgacatgaagagtggtgaaaaggtggccgtaaagaagctctcgcggccattt
cagtccatcatccacgccaagagaacgtacagagagctgcggttgctcaagcacatgaaa
catgaaaatgttattagcctcttagacgtctttaccccggcaacatctctaaaggaattc
aatgatgtgtacctggtgactcacctgatgggggcagatctcaacaacattgttaaatgt
cagaagctcacagacgaccatgtgcagttcctcatataccagatcctcagagggttaaag
tatattcactcagctggcataattcacagggatttaaaacctagtaacctggctgtgaat
gaagactgtgagctgaggattttagattttggtttggcgcgacacactgacgatgagatg
actggttacgtagcaacccgctggtatcgagcaccggagattgtgttgaactggatgcat
tacaacatgacagtggatatttggtcggtgggatgtataatggcagaactcctcactgga
agaactctttttcctggcactgaccatataaaccaactacagcagataatgcgtctgaca
ggaacacccccagactctctaataagcaggatgcccagccaagaggctagaaactatgtc
agctcgttgccaaacatgcccaagaggaactttgctcatgttttcattggtgccaaccca
caagctgtggacctgctggagaaaatgttggttctggacactgacaagagaataaccgca
gccgaggccctggcacatccctactttgctcagtaccacgaccccgatgatgagcctgag
gctgagccttatgaccagagtttcgagagccgtgaactggaaatagatgagtggaaacga
ttaacctacgaggaagtttgcagtttctaa

KEGG   Cynoglossus semilaevis (tongue sole): 103384903
Entry
103384903         CDS       T04866                                 

Definition
(RefSeq) mitogen-activated protein kinase 13-like
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem04010  MAPK signaling pathway
csem04068  FoxO signaling pathway
csem04114  Oocyte meiosis
csem04218  Cellular senescence
csem04261  Adrenergic signaling in cardiomyocytes
csem04370  VEGF signaling pathway
csem04620  Toll-like receptor signaling pathway
csem04621  NOD-like receptor signaling pathway
csem04622  RIG-I-like receptor signaling pathway
csem04625  C-type lectin receptor signaling pathway
csem04912  GnRH signaling pathway
csem04914  Progesterone-mediated oocyte maturation
csem05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:csem00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103384903
   04370 VEGF signaling pathway
    103384903
   04068 FoxO signaling pathway
    103384903
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    103384903
   04218 Cellular senescence
    103384903
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103384903
   04621 NOD-like receptor signaling pathway
    103384903
   04622 RIG-I-like receptor signaling pathway
    103384903
   04625 C-type lectin receptor signaling pathway
    103384903
  09152 Endocrine system
   04912 GnRH signaling pathway
    103384903
   04914 Progesterone-mediated oocyte maturation
    103384903
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103384903
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103384903
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:csem01001]
    103384903
Enzymes [BR:csem01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     103384903
Protein kinases [BR:csem01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   103384903
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo APH
Other DBs
NCBI-GeneID: 103384903
NCBI-ProteinID: XP_008316820
UniProt: A0A3P8UZQ0
LinkDB
Position
10
AA seq 363 aa
MEAQPHFSREEINSTVWEVPEKYTRLKQIGTGAYGAVCSAINERTKEKVALKKLHRPFQS
EIFAKRAYRELRLLKHMKHENVIGLLEVFTAASGLDDFQDFYLVMPYMFTDLSKVRGQLS
EDKVQFLVYQMLCGLRYIHKAGIIHRDLKPGNLAVNQDCELKILDFGLARSTDAEMTGYV
VTRWYRAPEVILNWMHYTQTVDIWSVGCIMAEMINGKTLFKGKDYMDQLTQIMKVTGVPG
PEFVQKLDSPEARSYIKGLPRYPRKDFSVLFTRASATGIDLLEKMLVLDGDERLTAELAL
EHSYFDGLRDPDDFPEPAPYDDSHDNATLSLEEWKRLCYKEVKSFVPFPRRDSKRKNTLT
MSP
NT seq 1092 nt   +upstreamnt  +downstreamnt
atggaggctcagccacatttctctcgggaggaaatcaatagcacagtgtgggaggtaccg
gagaaatacacacggctcaaacagataggaacaggagcatatggtgctgtgtgctcggcc
ataaatgagaggactaaagagaaagtggccctcaagaaactccacagacctttccagtca
gagatctttgctaagagggcctacagggagctgcggctgctcaaacacatgaagcacgag
aatgtgataggacttcttgaagtgtttacagctgcctctggccttgatgactttcaagac
ttctacctggtgatgccttacatgtttacagacttgtcaaaggttagaggccaactctca
gaggacaaagtccagtttctcgtctaccagatgctctgcggactcaggtatattcacaag
gctggcattattcacagggatctcaagcctggaaacttggcagtaaatcaggactgtgaa
ctcaagatcctggactttggtttggcacgcagtaccgatgcggagatgacaggctacgtg
gtgacccgttggtaccgggcacctgaggtcattctgaactggatgcactacactcagact
gtggacatctggtctgtgggctgcatcatggcagaaatgatcaatgggaaaactcttttt
aaaggaaaagactacatggaccagctgactcagatcatgaaagtgactggagtgcctgga
ccagagttcgtacagaagttggacagtccagaggctagaagttatataaagggccttcca
cgttatccccgaaaagacttttcagtgttgttcaccagagccagtgcaacaggtatcgac
ctgctggagaagatgctggttctcgatggagacgagaggctaacagcagaattagctttg
gaacattcttactttgatggtctaagagacccagatgactttcctgagccagcaccatat
gacgatagccatgacaacgcaacactgtccctagaggagtggaaacgattatgttacaaa
gaggtgaaaagcttcgtgcccttcccacggcgagactccaagagaaaaaacacactgaca
atgtctccgtga

KEGG   Cynoglossus semilaevis (tongue sole): 103386138
Entry
103386138         CDS       T04866                                 

Definition
(RefSeq) mitogen-activated protein kinase 14A isoform X1
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem04010  MAPK signaling pathway
csem04068  FoxO signaling pathway
csem04114  Oocyte meiosis
csem04218  Cellular senescence
csem04261  Adrenergic signaling in cardiomyocytes
csem04370  VEGF signaling pathway
csem04620  Toll-like receptor signaling pathway
csem04621  NOD-like receptor signaling pathway
csem04622  RIG-I-like receptor signaling pathway
csem04625  C-type lectin receptor signaling pathway
csem04912  GnRH signaling pathway
csem04914  Progesterone-mediated oocyte maturation
csem05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:csem00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103386138
   04370 VEGF signaling pathway
    103386138
   04068 FoxO signaling pathway
    103386138
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    103386138
   04218 Cellular senescence
    103386138
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103386138
   04621 NOD-like receptor signaling pathway
    103386138
   04622 RIG-I-like receptor signaling pathway
    103386138
   04625 C-type lectin receptor signaling pathway
    103386138
  09152 Endocrine system
   04912 GnRH signaling pathway
    103386138
   04914 Progesterone-mediated oocyte maturation
    103386138
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103386138
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103386138
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:csem01001]
    103386138
Enzymes [BR:csem01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     103386138
Protein kinases [BR:csem01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   103386138
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo APH Kinase-like
Other DBs
NCBI-GeneID: 103386138
NCBI-ProteinID: XP_008318490
UniProt: A0A3P8V4A8
LinkDB
Position
11
AA seq 361 aa
MSQKERPAFYRQELNKTVWEVPERYQNLSPVGSGAYGSVCSAYDVKTGLKVAVKKLSRPF
QSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPATTLEEFSDVYLVTHLMGADLNNIVKC
QKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEM
TGYVATRWYRAPEIMLNWMHYNMTVDIWSVGCIMAELLTGRTLFPGTDHINQLQQIMRLT
GTPPASLISRMPSHEARNYINSLPHMPKRNFAHVFIGANPLAVDLLEKMLVLDTDKRITA
SEALAHPYFAQYHDPEDEPEAEPYDQSFESRELEIEEWKKLTYEEVVSFIPPSFDVDEME
S
NT seq 1086 nt   +upstreamnt  +downstreamnt
atgtcgcaaaaagagagacccgctttctaccgacaggagcttaataaaaccgtgtgggaa
gtcccggagcgctaccagaacctttctccagttggctccggcgcgtacggatccgtgtgt
tcagcgtatgacgtgaagacaggcctgaaggtggcggtgaagaaattgtcgagacccttc
cagtcaataatccatgcaaagagaacctacagagagctgcggctgctgaaacatatgaaa
cacgagaatgtcattgggctgttagatgttttcacaccagcgacgaccttagaagagttc
agtgatgtgtatttggtgacccacctaatgggggctgatctgaacaacattgtaaagtgt
cagaagctgactgatgaccacgtccagttcctcatctaccagatcctcagaggtttaaag
tacatccattctgctgacatcatccacagagacctgaagcccagtaatctggcagtgaat
gaagactgtgagctcaagattctagactttggcctggcacggcacacagatgacgaaatg
acaggatatgtagccacgcggtggtacagagccccagagatcatgctcaactggatgcat
tacaacatgacagtggacatctggtcagtgggctgcatcatggctgaactgctcacagga
cgaacacttttccctggtacagaccatataaaccagctgcagcagataatgcgcctgacg
gggacacccccggcctccctcataagcaggatgcccagccatgaggcacggaactacata
aattccctccctcacatgccgaagaggaactttgctcacgtgtttattggtgccaatcct
ctggctgtggatttgctggagaaaatgctggttttggacacggacaagcgcatcactgcc
tccgaggccctcgcccacccctactttgcccagtatcacgaccccgaagatgagcctgaa
gcagagccttatgaccagagctttgaaagccgtgagctggaaatcgaggagtggaagaag
ttgacctacgaggaggtcgtcagcttcatcccgccctcatttgatgttgacgagatggaa
tcgtga

DBGET integrated database retrieval system