KEGG   Cynoglossus semilaevis (tongue sole): 103380821
Entry
103380821         CDS       T04866                                 

Definition
(RefSeq) transcription factor GATA-4
  KO
K09183  GATA-binding protein 4
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem04218  Cellular senescence
csem04530  Tight junction
Brite
KEGG Orthology (KO) [BR:csem00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    103380821
  09144 Cellular community - eukaryotes
   04530 Tight junction
    103380821
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:csem03000]
    103380821
Transcription factors [BR:csem03000]
 Eukaryotic type
  Zinc finger
   Cys4 GATA-factors
    103380821
SSDB
Motif
Pfam: GATA-N GATA TF_Zn_Ribbon Zn-ribbon_8 Zn_Tnp_IS1595
Other DBs
NCBI-GeneID: 103380821
NCBI-ProteinID: XP_008311141
UniProt: A0A3P8WZK1
LinkDB
Position
7
AA seq 402 aa
MYQGIMSTNHGPSSYEAGFLHNSSAATSPVYVPTTRVVTPMIPALPYLQTPGASQQSSPV
STHSAWAQPGAESVSSYNHSPVSPRFSFSTSPPLSCAVSTARDTVASSYSSPLNIPTNGR
EHYGARGLSGSYHSPYTAYMSPNMGGTWPTSPFDSPVLHGLQGGAAAGSARHPNIDFFDD
FAEGRECVNCGAMSTPLWRRDGTGHYLCNACGLYHKMNGINRPLIKPQRRLSASRRVGLS
CTNCHTTTTTLWRRNAEGEPVCNACGLYMKLHGVPRPLAMKKEGIQTRKRKPKNLNKPPT
ESPGSETTTVTTSSTPRTAAPSSSNSSSSSSISSSSTEEPRQIKTEPEAHSLFMHHSAHT
QISALPAYMSAQGGAIPLKMSPGSLGVTSSSKAEPWNNLILA
NT seq 1209 nt   +upstreamnt  +downstreamnt
atgtaccagggaataatgagcaccaaccacggaccctcgtcctacgaggccggatttctg
cacaactcctcggctgccacctccccggtctatgtgcccaccacccgggtcgtcaccccc
atgatcccggcgctgccctacctccagacacccggggcgtcacagcagagcagcccggtg
tccacgcactccgcctgggcacagccgggtgcggagtcggtgtcctcctacaaccactca
ccggtgtctccgcggttctccttctccaccagtccgccactgtcctgcgcggtctccacg
gcccgggacacggtggcctcctcctacagcagccccctgaacatccctacgaacggcagg
gagcactacggagcccggggcctcagcggctcctaccacagtccctacaccgcctacatg
agccccaacatgggcgggacgtggccgacgtctcccttcgacagtccggttctccacggt
ctgcagggcggtgctgctgcaggatctgcacgacatccaaacatagatttcttcgatgac
ttcgccgagggtcgagaatgtgtgaactgtggggccatgtcgacacccctgtggaggagg
gacggtactggacactacctgtgtaacgcctgcggtctgtaccacaagatgaacggcatc
aacagacctctcatcaaaccacaaagacgactgtctgcctccaggagggtgggcctgtcc
tgcaccaactgtcacaccaccaccaccacactgtggcgacggaacgcagagggagagccg
gtctgtaacgcctgtggtctctacatgaaactccacggggtaccccgacccctggctatg
aaaaaagaagggatccagacccgcaaacgtaaacccaagaacctcaacaagccaccgaca
gaatcccccggcagtgagaccactacagtcacaaccagcagcactcctcgcactgctgcc
cccagcagcagcaacagtagcagcagcagcagcatcagcagcagcagcacagaggagcct
cgacagataaagacagagcccgaggctcacagtttgttcatgcaccacagcgcacacaca
cagatctcagccttaccagcctacatgtcagctcaaggtggcgctatcccccttaagatg
tcacctggcagcctcggtgtaacttccagctccaaagccgaaccctggaacaacctcatc
ttggcttaa

DBGET integrated database retrieval system