KEGG   Cynoglossus semilaevis (tongue sole): 103380966Help
Entry
103380966         CDS       T04866                                 

Gene name
sod2
Definition
(RefSeq) superoxide dismutase [Mn], mitochondrial
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem04068  FoxO signaling pathway
csem04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:csem00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    103380966 (sod2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    103380966 (sod2)
Enzymes [BR:csem01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     103380966 (sod2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-GeneID: 103380966
NCBI-ProteinID: XP_008311338
LinkDB All DBs
Position
7
AA seq 225 aa AA seqDB search
MLCRVAQIRRCAASLSQTVSKVTATRQKHTLPDLTYDYGALEPHISAEIMQLHHSKHHAT
YVNNLNITEEKYQEALAKGDVTAQVSLQAALKFNGGGHINHTIFWTNLSPNGGGEPQGEL
MEAIKRDFGSFQNMKEKMSAATVAVQGSGWGWLGYDKESGRLRVAACANQDPLLGTTGLI
PLLGIDVWEHAYYLQYKNVRPDYVKAIWNIINWENVSDRLQTAKK
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgctttgcagagttgctcaaatacgcaggtgtgcagccagcctcagtcaaactgttagc
aaagtcactgcaacgaggcagaagcacacactgcccgacttaacgtacgactatggggct
ctggagcctcacatcagtgcagagattatgcagctgcaccacagcaaacatcatgccaca
tatgtgaacaacctcaacatcaccgaggagaaatatcaagaggctctggcaaaaggtgat
gtgacagcacaggtttccctccaggctgccctcaagtttaacggtggaggccacatcaac
cacactatcttttggacaaacctttctccaaatggtggaggcgagccacagggagaactt
atggaagccatcaaaagagactttggttccttccagaatatgaaagagaaaatgtctgct
gccactgtagcagtgcagggttctggctggggatggttaggctatgataaagagagtggc
agactccgtgttgctgcttgtgctaaccaggatcctctgctggggacaacaggtctcatc
cctcttcttggtattgatgtgtgggaacacgcatactaccttcaatataaaaatgtgcgt
ccggactacgttaaagcaatctggaatattatcaactgggaaaatgtgagcgatcgtctt
caaactgctaaaaagtaa

DBGET integrated database retrieval system