KEGG   Cynoglossus semilaevis (tongue sole): 103381542Help
Entry
103381542         CDS       T04866                                 

Definition
(RefSeq) neutral alpha-glucosidase C-like isoform X1
  KO
K12317  neutral alpha-glucosidase C [EC:3.2.1.20]
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem00052  Galactose metabolism
csem00500  Starch and sucrose metabolism
csem01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csem00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    103381542
   00500 Starch and sucrose metabolism
    103381542
Enzymes [BR:csem01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     103381542
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 103381542
NCBI-ProteinID: XP_016890007
LinkDB All DBs
Position
1
AA seq 954 aa AA seqDB search
MAEDGGQVVVSVVPGEDQPKDRFKKSQDVAFYRRQMQGPDIKHRALLDTLVLTEKGARVE
LQECDTQTKLLLLISSFKNDTVRISIDELQPIRARYRVQDVITAEPQCEQLRVEKQTKDS
VTFTWSSGRHKISVWRFPFRLEILCEGEQLLTFNSKEKLWFEALQHPPSDSYPGSEDSPW
KETFKTFVDIKANGPSSVGADVRLHGFSHLYGLPEHADSLQLKDTRDGEPYRLYNLDVFA
YDLHSRLGLYGSVPLLVAHKPHRTLGVFWLNASETFVNINSSDSQDDQTPPVKRRRTQPL
TDVHFLSESGVIDCMVLLGPSPQQVFRQYAQLTGTHPVFILPHSSNHVEVRLYVTLFFPA
VSGFQALPPLFALGYHQCRWNYDSEADVKSVDAGFDLHHIPYDVIWLDIEHTDGKRYFTW
DHVHFPDPAGLQRHLEKKKRKLVVINDPHIKADPDWPLFCEVRDGGHFVKDRGGEIYHGS
CWPGKSCYLDFSNAATRAWYSKCFALQKYKGSTPSLFVWNDMNEPSVFDGPEQTMPKDAV
HHGGWEHRELHNLYGFYQHMATVEGLMSRSGGSLRPFVLSRSFFAGSQRFGAVWTGDNVA
NWDYLKISIPMLLSLSVAGIMFCGADVGGFTQDPDPELLVRWYQTAALQPFFRGHSAKET
NRREPWLFGEEVTDRIRTVIQQRYCLLPYWYTLFYQAHTSALLPIRPLWVQFPTEHTTFT
VDHQYMIGDYLILMSGQQLLFCNKCTSLRCFLWSDAGGALLVSPVTDPGVQEVQLLLPGS
AEVWYDVESSKAYSGGRMLSLPVTLDTVPMFQRGGSVVCRSTGSGSCTAEQQQLPLSLTV
ALNSQGAADGELYLDDGHSFSYRDRKSFCLRRFSLLSGRLLCRSATDDGSYHCDTTVRSV
TILGVKRRPSAVTVLMSDGKETPVDFEFKQTSCQLTLNSLDLRVTVDWEIQITG
NT seq 2865 nt NT seq  +upstreamnt  +downstreamnt
atggctgaagacgggggtcaagtcgtggttagtgttgttcctggtgaggatcagcccaaa
gataggttcaagaagagtcaagatgttgcattttacaggcgacagatgcaaggtccagat
attaagcaccgagctcttctggacaccttggtgctcacagagaagggagcacgagtcgaa
ctgcaggagtgtgacactcagacaaagcttcttttgctgatttcatcttttaaaaatgat
accgtgagaatatcgatagatgaactgcagcccattcgagcgcggtacagagttcaggat
gtgatcacagcagaaccccagtgtgaacagttaagagtagagaagcagaccaaggactct
gtcaccttcacttggtcgtcaggacgtcacaagatctctgtgtggcgttttcctttcaga
ctagagatcctgtgtgaaggtgaacagctgctcacctttaattctaaagaaaagctgtgg
tttgaggccctgcagcatccacccagtgactcatatcctggcagtgaggattcaccgtgg
aaagaaactttcaaaacctttgtggacatcaaagctaatggtcccagcagcgttggtgcg
gacgtccgtctccatggcttcagtcacctgtacggtcttccagaacacgctgacagcctg
cagctcaaagacaccagagatggtgaaccctatcgtctctacaacctggacgtctttgct
tacgacctgcacagccgcctgggtctgtatggatccgtgccattgctggtcgcccacaaa
ccccacagaactctgggagtgttctggttgaacgcatcagagacatttgtgaacattaat
agcagtgacagccaggatgaccaaacacccccagttaagagacggaggacacagcctctg
acagacgtccacttcctgtcagagagtggtgtcatagactgcatggttctgctgggaccg
agtccacagcaggtcttcagacagtatgcccaactgacgggtacacacccagtattcatt
ctacctcattcttctaaccatgtggaagtaagactttatgtaacactcttttttcctgct
gtgtcaggattccaggctctgcctcctctctttgccctggggtatcaccagtgtcgctgg
aactacgacagcgaggctgatgtcaagtctgttgatgctggattcgatcttcaccacatc
ccctacgacgtcatctggttggacattgagcacactgatgggaagcgttacttcacttgg
gaccatgttcattttcctgatcctgctggattgcagcgccacctggagaagaagaagagg
aagctggtggttattaatgatcctcacatcaaagctgatcctgattggccgctgttctgt
gaggtcagagacggaggacattttgttaaagacagaggaggagagatttaccacggctca
tgttggcctgggaagtcctgctaccttgacttcagtaatgctgccaccagagcctggtac
tccaaatgctttgctctgcaaaagtacaaaggttccactccatctttatttgtgtggaat
gacatgaatgaaccgtctgtgtttgacgggccggagcaaaccatgccaaaggatgcagtg
catcatgggggctgggagcacagagaactgcacaatctgtatggtttttaccagcacatg
gccacagttgaaggtttgatgagtcgctcaggaggctcactgagacctttcgttctttct
cgctccttcttcgctggctcacagaggtttggtgctgtatggaccggtgataacgtggcc
aactgggactatctgaagatctccattcccatgcttttgtctctgagtgtggcaggaatt
atgttttgtggagccgacgtcggtgggtttactcaggatccagacccggagctgctggtc
cgctggtaccagactgctgccctgcagcccttttttcggggtcactctgccaaagagacg
aaccgcagagagccgtggctctttggagaggaggtcactgatagaatacgcactgtaatc
caacagaggtactgtctgctgccatactggtacactctgttctaccaggctcacacatct
gctctgcttccaatcagacctctgtgggtgcagtttccaactgaacacaccaccttcact
gtggaccaccagtacatgattggtgattatttgatattaatgtctggacagcagctgtta
ttctgtaataaatgcacttcactcagatgttttctctggtctgatgcaggaggagctctg
ctggtctctcctgtcactgaccctggggttcaggaagtccagctcttacttcctggatct
gctgaggtctggtatgacgttgagtcttcaaaggcctacagtggagggaggatgctgagc
cttcctgtcaccctggacacagttcctatgttccagcgtggtggatcagtggtctgcagg
tcaacagggagtggttcctgcacagctgagcagcagcagctacctctgtcactcacggtg
gctctaaactctcagggagctgctgacggtgagttgtacctggacgatggccactcattc
agctacagagacagaaagtccttctgtctgcgcaggttcagcctgctgtcaggacgtctg
ctctgtcgttctgccactgacgatgggtcctatcactgtgataccactgtacgctccgtc
accatcctgggtgtaaagcgccgaccgtctgcggtgactgtgctaatgtcagatggcaag
gaaactcctgtggactttgagttcaaacagacaagctgccagctcacactgaacagtctg
gacctcagggtgaccgtggactgggagatacagatcacaggttaa

DBGET integrated database retrieval system