KEGG   Cynoglossus semilaevis (tongue sole): 103382085
Entry
103382085         CDS       T04866                                 

Definition
(RefSeq) casein kinase I-like
  KO
K08960  casein kinase 1, epsilon [EC:2.7.11.1]
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem04068  FoxO signaling pathway
csem04310  Wnt signaling pathway
csem04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:csem00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    103382085
   04340 Hedgehog signaling pathway
    103382085
   04068 FoxO signaling pathway
    103382085
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:csem01001]
    103382085
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:csem03036]
    103382085
Enzymes [BR:csem01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     103382085
Protein kinases [BR:csem01001]
 Serine/threonine kinases: CK1 group
  CK1 family [OT]
   103382085
Chromosome and associated proteins [BR:csem03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    103382085
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal APH Pox_ser-thr_kin Kdo
Other DBs
NCBI-GeneID: 103382085
NCBI-ProteinID: XP_008312966
UniProt: A0A3P8X1L7
LinkDB
Position
8
AA seq 421 aa
MELRVGNKYRLGRKIGSGSFGDIYLGSNIATGEEVAIKLECVKTKHPQLHIESKFYKMMQ
GGVGIPSIKWCGAEGDYNVMVMELLGPSLEDLFNFCSRKFSLKTVLLLADQMISRIEYIH
SKNFIHRDVKPDNFLMGLGKKGNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYA
SINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVL
CKGYPSEFSTYLNLCRSLRFDDKPDYSFLRQLFRNLFHRQGFSYDYVFDWNMLKFGASRT
TEDCDRERREGKDGEERGGGGQRGAGGRGLPPGPNPSAANRVRNEADAAAPSNPATRGGQ
QAANRSPQAGRAERAERERKVAMRLHRGAPANVSSSELNARLDQSRITASQVSVPFEHLA
K
NT seq 1266 nt   +upstreamnt  +downstreamnt
atggagttgagggtaggaaacaagtatcgtcttgggcggaagattggtagtggatccttt
ggagatatttatctgggctctaacattgccacaggagaggaagtggccatcaaactcgaa
tgtgtgaaaaccaaacacccacagctccacatcgagagcaagttctacaagatgatgcag
ggtggagtgggcattccatctataaagtggtgtggagctgaaggagactacaacgtgatg
gtgatggagctgctaggccccagtctggaggatctgttcaacttctgctccagaaagttc
agtctgaagacggtgctgctgctggctgaccagatgatcagcaggatcgagtacatccac
tccaagaactttatccacagagatgtgaagcccgataatttcctgatgggacttggcaaa
aagggcaacttggtctacattatcgactttggtctggccaagaaataccgtgacgcccga
acacaccagcacatcccttaccgtgagaataagaacctcactggaacggcccgatatgcc
tccatcaacactcatctgggaattgagcagtcgaggagagatgatttggagtctttaggc
tatgttctcatgtacttcaacctgggttctctgccctggcagggcctgaaggctgccacc
aagaggcagaaatatgagcgcatcagtgagaagaaaatgtccacacccatcgaggtgctc
tgcaaaggttacccctctgagttctccacttacctgaatttgtgtcgctcgctgcgattt
gacgacaagcctgactactccttcctgaggcagctcttcagaaaccttttccacagacag
ggcttttcctacgactacgtctttgactggaacatgctaaagtttggagccagcagaaca
acagaggattgcgacagagagagaagggaaggcaaagacggcgaggaacgaggaggtgga
ggccagagaggtgctggaggtcgaggtctgccgcctggaccaaacccttcagcagccaac
agggtcagaaatgaagctgatgctgctgctccttcaaacccagccacacgaggggggcag
caggcagcaaaccgttcacctcaggctggaagggcggagcgcgcagagagagaaaggaag
gtggccatgaggcttcatcgtggagccccagccaatgtctcctcctccgagctcaatgca
cgcctggaccaatctcgtatcacagcatcacaggtcagcgtaccgtttgaacatctggca
aagtga

KEGG   Cynoglossus semilaevis (tongue sole): 103393353
Entry
103393353         CDS       T04866                                 

Gene name
csnk1e
Definition
(RefSeq) casein kinase I
  KO
K08960  casein kinase 1, epsilon [EC:2.7.11.1]
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem04068  FoxO signaling pathway
csem04310  Wnt signaling pathway
csem04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:csem00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    103393353 (csnk1e)
   04340 Hedgehog signaling pathway
    103393353 (csnk1e)
   04068 FoxO signaling pathway
    103393353 (csnk1e)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:csem01001]
    103393353 (csnk1e)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:csem03036]
    103393353 (csnk1e)
Enzymes [BR:csem01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     103393353 (csnk1e)
Protein kinases [BR:csem01001]
 Serine/threonine kinases: CK1 group
  CK1 family [OT]
   103393353 (csnk1e)
Chromosome and associated proteins [BR:csem03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    103393353 (csnk1e)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal APH Pox_ser-thr_kin Kdo
Other DBs
NCBI-GeneID: 103393353
NCBI-ProteinID: XP_008328512
UniProt: A0A3P8V8F3
LinkDB
Position
17
AA seq 414 aa
MELRVGNKYRLGRKIGSGSFGDIYLGANIATGEEVAIKLECVKTKHPQLHIESKFYKMMQ
GGVGIPSIKWCGAEGDYNVMVMELLGPSLEDLFNFCSRKFSLKTVLLLADQMISRIEYIH
SKNFIHRDVKPDNFLMGLGKKGNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYA
SINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVL
CKGYPSEFSTYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDWNMLKFGAGRT
AEDGERERRTGEDREERIVGAPRGSASRGLPPGPNPVVPNRVRNGPEQAISNPASRVQQS
GNTSPRAISRAERERKVSMRLHRGAPANISSSDLTARHDQSRSQVSVPFEHMGK
NT seq 1245 nt   +upstreamnt  +downstreamnt
atggagctgagagtggggaacaagtaccgactcgggcggaagatagggagcggttctttt
ggagatatttatctgggtgccaacattgccactggtgaggaggtggccatcaaactggag
tgtgtgaagaccaaacacccacaactgcacattgaaagcaagttttacaagatgatgcaa
ggaggagtgggtattccatccataaagtggtgtggtgctgagggagactacaacgtgatg
gtgatggagctgctgggtcccagcctggaggacttgtttaacttttgctcacgcaagttc
agcctgaagacggttctccttttggcagatcagatgattagccgcatcgagtacatccac
tccaagaacttcatccatcgtgacgtcaagcctgacaacttcctcatgggccttggcaag
aagggcaacctggtctacatcattgactttggcctggccaagaagtaccgagacgcccgc
acgcaccagcacattccttatagggagaacaagaacttgactggcacagcacgctacgcc
tctatcaacacacatctgggaatcgagcagtccagacgtgacgacctggaatccctggga
tatgtcctaatgtacttcaacctgggctcgctcccgtggcagggcctcaaggcggcgacc
aagagacagaagtatgaaaggatcagtgagaagaaaatgtccactcccattgaggtcctc
tgcaaaggttacccttctgagttctccacatatctgaacttctgccgttccctgcgcttt
gacgacaaaccagactattcttacctacgacagctcttcaggaatctttttcaccgacag
ggtttctcctacgactatgttttcgattggaacatgttgaagtttggtgccggtcggaca
gcagaggacggtgaacgggaaagaaggacaggagaagacagggaggagcgaatcgtagga
gctcccagaggctctgcatcccgcggccttcccccaggtcccaacccagtagttcccaac
agggtcaggaacgggccggagcaggccatttctaaccctgcctcccgggtccaacagtct
ggaaatacgtcgccacgtgcaatctcccgtgcagagagggagaggaaggtgagcatgcgg
ctccaccgtggggctccagccaatatttcgtcatctgacctcacggcccgtcatgaccag
tccagatcacaggtcagcgtgccatttgaacacatggggaaatag

DBGET integrated database retrieval system