KEGG   Cynoglossus semilaevis (tongue sole): 103382123
Entry
103382123         CDS       T04866                                 

Definition
(RefSeq) mitogen-activated protein kinase 8 isoform X1
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem04010  MAPK signaling pathway
csem04012  ErbB signaling pathway
csem04068  FoxO signaling pathway
csem04137  Mitophagy - animal
csem04140  Autophagy - animal
csem04141  Protein processing in endoplasmic reticulum
csem04210  Apoptosis
csem04217  Necroptosis
csem04310  Wnt signaling pathway
csem04510  Focal adhesion
csem04530  Tight junction
csem04620  Toll-like receptor signaling pathway
csem04621  NOD-like receptor signaling pathway
csem04622  RIG-I-like receptor signaling pathway
csem04625  C-type lectin receptor signaling pathway
csem04910  Insulin signaling pathway
csem04912  GnRH signaling pathway
csem04914  Progesterone-mediated oocyte maturation
csem04920  Adipocytokine signaling pathway
csem05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:csem00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    103382123
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103382123
   04012 ErbB signaling pathway
    103382123
   04310 Wnt signaling pathway
    103382123
   04068 FoxO signaling pathway
    103382123
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103382123
   04137 Mitophagy - animal
    103382123
  09143 Cell growth and death
   04210 Apoptosis
    103382123
   04217 Necroptosis
    103382123
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103382123
   04530 Tight junction
    103382123
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103382123
   04621 NOD-like receptor signaling pathway
    103382123
   04622 RIG-I-like receptor signaling pathway
    103382123
   04625 C-type lectin receptor signaling pathway
    103382123
  09152 Endocrine system
   04910 Insulin signaling pathway
    103382123
   04920 Adipocytokine signaling pathway
    103382123
   04912 GnRH signaling pathway
    103382123
   04914 Progesterone-mediated oocyte maturation
    103382123
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103382123
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:csem01001]
    103382123
Enzymes [BR:csem01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     103382123
Protein kinases [BR:csem01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   103382123
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo APH RIO1 Kinase-like
Other DBs
NCBI-GeneID: 103382123
NCBI-ProteinID: XP_016890068
UniProt: A0A3P8WYS2
LinkDB
Position
8
AA seq 383 aa
MNRNKREKEYYSIDVGDSTFMVLKRYQNLRPIGSGAQGIVCSAYDHILERNVAIKKLSRP
FQNQTHAKRAYRELVLMKCVNHKNIIGLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIQ
MELDHERLSYLLYQMLCGIKHLHAAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAATGL
LMTPYVVTRYYRAPEVILGMGYQANVDVWSVGCIMAEMVRGSVLFPGTDHIDQWNKVIEQ
LGTPSQEFLMKLNQSVRTYVENRPRYAGYSFEKLFPDVLFPADSEHNKLKASQARDLLSK
MLVIDASKRISVDEALQHAYINVWYDPSEVEAPPPAITDKQLDEREHTVEEWKELIYKEV
LDWEERTKNGIIRGQPASIAQVQ
NT seq 1152 nt   +upstreamnt  +downstreamnt
atgaaccgaaacaagcgcgagaaggagtactacagtatagatgtgggcgattcaactttc
atggttttaaagcgctaccagaacctcaggcccattggatccggggcacaagggattgta
tgttctgcgtacgaccacatcctggagagaaatgtggccatcaagaagctgagtcggcct
tttcagaatcaaacccatgcgaaacgggcctacagagaactggtgctcatgaaatgtgtc
aaccataagaacataatcggattattaaatgtattcacgccgcaaaagacactggaagaa
ttccaagatgtgtatctcgtgatggagctgatggatgccaacctgtgccaggttattcag
atggagctggatcacgagaggctgtcctacctgctctaccagatgctgtgcggaatcaaa
cacctacacgctgcaggcatcatacacagggacctgaagcccagtaacattgtggtcaaa
tctgactgtactttgaagatcctggactttggtctggccagaacggcggctacaggtctc
ctcatgacaccctacgtggtgacccgctactaccgtgctcctgaggtcatcctgggtatg
ggctatcaggccaatgttgatgtctggtctgttggctgcatcatggccgaaatggtccgg
ggtagtgtgttgtttccaggcactgatcatatcgaccagtggaataaggtcatagagcag
ctggggacaccatctcaggaattcttgatgaaacttaaccagtcggtgcggacgtacgtg
gagaaccggccgcgatacgctggctacagctttgagaagctcttccctgacgtcctgttt
cctgcagactctgaacacaacaaactgaaagcgagccaagccagagacctgctgtccaag
atgctggttattgatgcgtctaaacggatctcggtggatgaagctctccagcacgcctac
ataaacgtgtggtacgacccgagtgaagtagaggctccaccaccagcgatcacagacaaa
caactggatgaaagagagcacacagtggaggaatggaaagagttgatatacaaagaagtg
ttggactgggaggagaggacaaagaacggcatcatccgaggacagccggcctcgatagca
caggtgcagtag

KEGG   Cynoglossus semilaevis (tongue sole): 103387363
Entry
103387363         CDS       T04866                                 

Definition
(RefSeq) mitogen-activated protein kinase 8-like isoform X1
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem04010  MAPK signaling pathway
csem04012  ErbB signaling pathway
csem04068  FoxO signaling pathway
csem04137  Mitophagy - animal
csem04140  Autophagy - animal
csem04141  Protein processing in endoplasmic reticulum
csem04210  Apoptosis
csem04217  Necroptosis
csem04310  Wnt signaling pathway
csem04510  Focal adhesion
csem04530  Tight junction
csem04620  Toll-like receptor signaling pathway
csem04621  NOD-like receptor signaling pathway
csem04622  RIG-I-like receptor signaling pathway
csem04625  C-type lectin receptor signaling pathway
csem04910  Insulin signaling pathway
csem04912  GnRH signaling pathway
csem04914  Progesterone-mediated oocyte maturation
csem04920  Adipocytokine signaling pathway
csem05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:csem00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    103387363
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103387363
   04012 ErbB signaling pathway
    103387363
   04310 Wnt signaling pathway
    103387363
   04068 FoxO signaling pathway
    103387363
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103387363
   04137 Mitophagy - animal
    103387363
  09143 Cell growth and death
   04210 Apoptosis
    103387363
   04217 Necroptosis
    103387363
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103387363
   04530 Tight junction
    103387363
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103387363
   04621 NOD-like receptor signaling pathway
    103387363
   04622 RIG-I-like receptor signaling pathway
    103387363
   04625 C-type lectin receptor signaling pathway
    103387363
  09152 Endocrine system
   04910 Insulin signaling pathway
    103387363
   04920 Adipocytokine signaling pathway
    103387363
   04912 GnRH signaling pathway
    103387363
   04914 Progesterone-mediated oocyte maturation
    103387363
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103387363
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:csem01001]
    103387363
Enzymes [BR:csem01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     103387363
Protein kinases [BR:csem01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   103387363
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo APH RIO1 Kinase-like
Other DBs
NCBI-GeneID: 103387363
NCBI-ProteinID: XP_008320183
UniProt: A0A3P8VEQ5
LinkDB
Position
12
AA seq 438 aa
MNKNKKDREFYSLDVGDSTFTVLKRYQNLRPIGSGAQGIVCSAYDQVLERNVAIKKLSRP
FQNQTHAKRAYRELVLMKCVNHKNIIGLLNVFTPQKSLEEFQDVYLVMELMDANLCQVIQ
MELDHERLSYLLYQMLCGIKHLHAAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAATGL
LMTPYVVTRYYRAPEVILGMGYQANVDVWSVGCIVAEMIRGSVLFPGTDHIDQWNKVIEQ
LGTPSQDFLMKLNQSVRTYVENRPRYAGYTFEKLFPDVLFPADSDHNKLKASQARDLLSR
MLVIDASKRISVDEALQHPYINVWYDPAEVEAPPPKVLDKQLDEREHTVDEWKELIYKEV
SEWEDWKKNGVIRGQPAPLGAAVIDSPPQPTSSSSSSANDVSSMSTDPTDPCSDPTTTSE
TDSSLDGATTLGALACCR
NT seq 1317 nt   +upstreamnt  +downstreamnt
atgaacaaaaacaagaaagacagagagttctacagcctggatgttggagattcaaccttc
acagtgttaaagcgataccagaacctgaggcccattggctcaggggcacaggggattgta
tgttctgcttatgaccaagtccttgaaagaaatgttgccataaagaagctgagtcggccg
tttcaaaatcaaacccatgccaagagagcgtacagggagctggtcctaatgaaatgtgtc
aatcacaaaaatatcatcggccttttaaatgtattcacaccacagaagtcgttagaagaa
tttcaagatgtatacttggtgatggagctgatggatgccaacctgtgccaggtcattcag
atggagctggaccacgagaggctgtcttatctgctctaccagatgttgtgtggtatcaaa
cacctccacgccgctggtatcattcacagggacctcaaacccagtaacatagttgtgaag
tctgactgcactctgaagattctggactttggtttggctcggacagctgccacgggcctc
ctgatgacaccttatgtggttacacgttactacagagcaccagaggtcatcctgggtatg
ggctatcaagccaatgtggacgtatggtcagtgggctgcattgtggctgagatgatcagg
ggaagtgtgttgttccccggcactgatcacattgaccagtggaacaaagtcatagaacag
ttaggcactccatctcaggatttccttatgaagctgaaccagtcagtcagaacatacgtg
gaaaacaggccacgctacgctgggtacacctttgagaaactcttcccagacgttctgttc
cccgctgactctgaccacaacaaactgaaagcgagccaagctagggatctcctatccagg
atgttagtgatcgatgcttctaaacggatctcagtggacgaggcgctgcagcacccctac
attaatgtttggtacgacccagcagaagtggaggcgccacctccaaaggttttagacaaa
cagttggatgaaagggagcacacagtagacgagtggaaagagctaatttataaggaagtg
agtgaatgggaagactggaaaaaaaacggtgtgattagaggccagcctgctcctttaggt
gcagcagtgattgatagcccgcctcagcccacatcctcctcttcctcgtcagccaacgat
gtctcctcaatgtccaccgatcccactgacccctgcagtgaccccaccacgacctctgaa
acagacagcagcttggacggcgccaccacactgggtgctctggcctgctgcagataa

KEGG   Cynoglossus semilaevis (tongue sole): 103390257
Entry
103390257         CDS       T04866                                 

Gene name
mapk10
Definition
(RefSeq) mitogen-activated protein kinase 10 isoform X1
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem04010  MAPK signaling pathway
csem04012  ErbB signaling pathway
csem04068  FoxO signaling pathway
csem04137  Mitophagy - animal
csem04140  Autophagy - animal
csem04141  Protein processing in endoplasmic reticulum
csem04210  Apoptosis
csem04217  Necroptosis
csem04310  Wnt signaling pathway
csem04510  Focal adhesion
csem04530  Tight junction
csem04620  Toll-like receptor signaling pathway
csem04621  NOD-like receptor signaling pathway
csem04622  RIG-I-like receptor signaling pathway
csem04625  C-type lectin receptor signaling pathway
csem04910  Insulin signaling pathway
csem04912  GnRH signaling pathway
csem04914  Progesterone-mediated oocyte maturation
csem04920  Adipocytokine signaling pathway
csem05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:csem00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    103390257 (mapk10)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103390257 (mapk10)
   04012 ErbB signaling pathway
    103390257 (mapk10)
   04310 Wnt signaling pathway
    103390257 (mapk10)
   04068 FoxO signaling pathway
    103390257 (mapk10)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103390257 (mapk10)
   04137 Mitophagy - animal
    103390257 (mapk10)
  09143 Cell growth and death
   04210 Apoptosis
    103390257 (mapk10)
   04217 Necroptosis
    103390257 (mapk10)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103390257 (mapk10)
   04530 Tight junction
    103390257 (mapk10)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103390257 (mapk10)
   04621 NOD-like receptor signaling pathway
    103390257 (mapk10)
   04622 RIG-I-like receptor signaling pathway
    103390257 (mapk10)
   04625 C-type lectin receptor signaling pathway
    103390257 (mapk10)
  09152 Endocrine system
   04910 Insulin signaling pathway
    103390257 (mapk10)
   04920 Adipocytokine signaling pathway
    103390257 (mapk10)
   04912 GnRH signaling pathway
    103390257 (mapk10)
   04914 Progesterone-mediated oocyte maturation
    103390257 (mapk10)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103390257 (mapk10)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:csem01001]
    103390257 (mapk10)
Enzymes [BR:csem01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     103390257 (mapk10)
Protein kinases [BR:csem01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   103390257 (mapk10)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like APH RIO1 FTA2
Other DBs
NCBI-GeneID: 103390257
NCBI-ProteinID: XP_016894227
LinkDB
Position
14
AA seq 384 aa
MVFMSRHFLYNCSQPILDVKIAFCQGFGKQVDVSYIAKHYNMSKSKVDNQFYSVEVGDST
FTVLKRYQNLKPIGSGAQGIVCAGYDAVLDRNVAIKKLSRPFQNQTHAKRAYRELVLMKC
VNHKNIISLLNVFTPQKSLEEFQDVYLAMELMDANLCQVIQMELDHERMSYLLYQMLCGI
KHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSFMMTPYVVTRYYRAPEVILG
MGYKENVDIWSVGCIMGEMVRHKILFPGRDYIDQWNKVIEQLGTPSPEFMKKLQPTVRNY
VENRPKYAGLTFPKLFPDCLFPADSEHNKLKASQARDLLSKMLIIDPAKRISVDEALQHP
YINVWYDPAEVEALLSADLWMSTP
NT seq 1155 nt   +upstreamnt  +downstreamnt
atggtatttatgagcagacatttcttatacaactgcagccaaccaatcctggatgtgaag
atagccttttgtcagggttttggaaaacaagtggatgtgtcatatattgccaagcattac
aacatgagtaaaagcaaagtggacaaccagttctacagtgtggaagtgggagactccacc
ttcacagttttaaaacgctaccaaaacttaaagcccattggttctggagctcagggaatc
gtctgtgcgggctacgatgctgttctggacagaaatgtagccatcaagaaactgagcaga
cccttccagaaccagacccacgccaagcgggcatatcgagagttagtgctaatgaaatgt
gtcaatcacaaaaatattatcagtttattaaacgtcttcacaccacagaaatcattagag
gagtttcaagatgtgtacctagctatggagctgatggatgccaatctgtgtcaggtgatt
cagatggagctcgaccacgagagaatgtcctacctgctctatcagatgctgtgtggtatc
aaacacctgcactcagctggcatcattcacagggatctaaaaccaagcaatattgtggtg
aaatcagactgtaccctgaagatcctggactttggattggcaagaactgcaggcacaagc
ttcatgatgaccccgtacgtggtgacgagatactacagagcgccagaagtcatcctgggg
atgggatacaaagagaatgtggatatatggtcggtggggtgcattatgggagaaatggtg
cgccacaaaatcctcttccctggccgggactacatcgaccagtggaacaaggtgatcgag
cagctgggaacgccctcaccggagttcatgaagaagctccagcccacagtgaggaactat
gtggagaaccggccaaagtacgctggcctcacctttcccaagcttttccccgactgcctt
ttccctgctgactctgagcacaacaaactcaaagcaagccaggcccgagacctgctgtca
aaaatgttgatcatcgaccctgctaaacggatatctgtggacgaggcattacagcatcct
tacataaacgtttggtatgatccagctgaggtggaggcgctgctgagtgctgacctgtgg
atgtccacaccttaa

KEGG   Cynoglossus semilaevis (tongue sole): 103391026
Entry
103391026         CDS       T04866                                 

Definition
(RefSeq) mitogen-activated protein kinase 9
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem04010  MAPK signaling pathway
csem04012  ErbB signaling pathway
csem04068  FoxO signaling pathway
csem04137  Mitophagy - animal
csem04140  Autophagy - animal
csem04141  Protein processing in endoplasmic reticulum
csem04210  Apoptosis
csem04217  Necroptosis
csem04310  Wnt signaling pathway
csem04510  Focal adhesion
csem04530  Tight junction
csem04620  Toll-like receptor signaling pathway
csem04621  NOD-like receptor signaling pathway
csem04622  RIG-I-like receptor signaling pathway
csem04625  C-type lectin receptor signaling pathway
csem04910  Insulin signaling pathway
csem04912  GnRH signaling pathway
csem04914  Progesterone-mediated oocyte maturation
csem04920  Adipocytokine signaling pathway
csem05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:csem00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    103391026
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103391026
   04012 ErbB signaling pathway
    103391026
   04310 Wnt signaling pathway
    103391026
   04068 FoxO signaling pathway
    103391026
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103391026
   04137 Mitophagy - animal
    103391026
  09143 Cell growth and death
   04210 Apoptosis
    103391026
   04217 Necroptosis
    103391026
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103391026
   04530 Tight junction
    103391026
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103391026
   04621 NOD-like receptor signaling pathway
    103391026
   04622 RIG-I-like receptor signaling pathway
    103391026
   04625 C-type lectin receptor signaling pathway
    103391026
  09152 Endocrine system
   04910 Insulin signaling pathway
    103391026
   04920 Adipocytokine signaling pathway
    103391026
   04912 GnRH signaling pathway
    103391026
   04914 Progesterone-mediated oocyte maturation
    103391026
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103391026
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:csem01001]
    103391026
Enzymes [BR:csem01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     103391026
Protein kinases [BR:csem01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   103391026
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo APH Kinase-like RIO1
Other DBs
NCBI-GeneID: 103391026
NCBI-ProteinID: XP_016894944
LinkDB
Position
15
AA seq 315 aa
MELMDASLCQVIHMDLDHERMSYLLYQILCGIRHLHSAGIIHRDLKPSNIVVKSDCTLKI
LDFGLARTACTNFMMTPYVVTRYYRAPEVILGMKYKENVDIWSVGCIMGEMVKGSVIFQG
TDHIDQWNKVIEVLGTPSLDFMNRLMETVRNYVMNKPQYPGVSFAELFPDWAFPSDSEHD
KLKTSQARDLLSKMLVIDPESRISVEEALNHPYIHVWYDPAEADAPPPQISDKQLEEREH
TIEQWKELIYEEVIDWEERNKNGLMKEDCSDAVSGSASQSSSANDISSMSTEQTLASDTD
SSSIDTLTGPLDESQ
NT seq 948 nt   +upstreamnt  +downstreamnt
atggagctgatggatgccagcctctgtcaggtgatccacatggacctggaccatgagagg
atgtcctacctgctctaccagattctctgtggcatcagacacttgcactctgctggcatt
attcacagggacctgaagcccagtaacatcgtggtaaagtcggactgcacccttaagatc
ttggatttcggcctggcccgaacagcttgcactaacttcatgatgactccatacgtggtg
accagatactacagagccccagaggtcatcctgggcatgaagtacaaggagaacgtggac
atctggtcggtgggttgcatcatgggagagatggtcaaaggcagcgtgatcttccagggc
actgaccacattgaccagtggaataaggtgattgaggttctgggcacacccagtctggac
ttcatgaaccgactaatggagactgtaaggaactacgtgatgaacaaaccacagtatcct
ggcgtgagcttcgctgagcttttcccagactgggcctttccatctgactcagagcacgac
aagctgaagacgagtcaagcgcgggacctgctgtccaaaatgctggttattgatcctgag
agtcgcatctcggttgaagaagccctcaaccacccctacattcacgtgtggtacgaccct
gcagaagctgacgcgccacctccccagatttcagacaagcagctggaagagagagagcac
accattgagcaatggaaagaacttatttatgaagaggtgattgactgggaagaaagaaac
aagaacggcctgatgaaagaagattgctctgatgctgtgtcaggctccgcctcccagtcc
tcgtcagccaacgacatttcgtccatgtccacggagcagaccctggcctcggacacagac
agcagcagcatcgacacactgacaggaccgctggacgagagtcagtga

DBGET integrated database retrieval system