KEGG   Cynoglossus semilaevis (tongue sole): 103382446
Entry
103382446         CDS       T04866                                 

Gene name
mdm2
Definition
(RefSeq) E3 ubiquitin-protein ligase Mdm2
  KO
K06643  E3 ubiquitin-protein ligase Mdm2 [EC:2.3.2.27]
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem04068  FoxO signaling pathway
csem04110  Cell cycle
csem04115  p53 signaling pathway
csem04120  Ubiquitin mediated proteolysis
csem04144  Endocytosis
csem04218  Cellular senescence
csem04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:csem00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    103382446 (mdm2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    103382446 (mdm2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    103382446 (mdm2)
  09143 Cell growth and death
   04110 Cell cycle
    103382446 (mdm2)
   04115 p53 signaling pathway
    103382446 (mdm2)
   04218 Cellular senescence
    103382446 (mdm2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    103382446 (mdm2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:csem04131]
    103382446 (mdm2)
   04121 Ubiquitin system [BR:csem04121]
    103382446 (mdm2)
Enzymes [BR:csem01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     103382446 (mdm2)
Membrane trafficking [BR:csem04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    103382446 (mdm2)
Ubiquitin system [BR:csem04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   MDM2/MDM4 proteins
    103382446 (mdm2)
SSDB
Motif
Pfam: zf-C3HC4_3 SWIB zf-RanBP Nucleo_P87
Other DBs
NCBI-GeneID: 103382446
NCBI-ProteinID: XP_008313472
LinkDB
Position
8
AA seq 503 aa
MSAEGLRTDTQDEDKLVRPKLEFHSLLQDAGATKDLLTMKEVMFYLGQYIIQKKLYDQSQ
QHIVHCAQDELGRVLGVDSFSVKEPRVLFAMITKNLETVREDVPSSVGEGHSQNQTNTEE
ADSESRSSSPDRRRRRRRRRRRHRSCRSSDAGPSHSVQEEENEGETEDEEEEDDRRKRRR
SDSYSLTFDESLSWCVIGGLGRVRDLQSSQSSDTHSTSAQSEVTIPGPESDCDNFSVEFE
VESIDSDDYNEDDASVSADDQVYEVTIFEADDEDDSFDEDTEITEADYWRCVKCDELNPP
LPRNCLRCWTLRRDWLPEESRGLDNTSPYWHKALPTKPSSQSAAKEAAEAYDVEEHEGMD
VPDGKRAKTPSSQHLSDSNPSSAPCSQDLLCSSQPSSSSYSSSFDSQELLQLSNTTSPQP
STPASSTSVPELERSSSAEWRLPDSCLDPCLICQSRPKNGCIVHGRTGHLMSCYVCARKL
KKRNKLCPVCRLPIQSVVLTYIS
NT seq 1512 nt   +upstreamnt  +downstreamnt
atgtcagcagaagggctacgcactgacactcaagatgaagacaaactggtgagaccaaag
ttggagtttcactccctgctgcaggatgcaggagccaccaaagatctgctcacgatgaag
gaggtgatgttttacctgggtcagtatatcatccagaagaagctttatgatcagagtcag
cagcacatcgtccactgcgcccaggatgaactgggccgagtgctgggcgtcgacagcttc
tctgtgaaagaaccacgagttttgtttgcaatgatcacaaaaaacctggagactgtgaga
gaagatgtgccatctagtgttggagaaggacacagccaaaatcagactaacacagaggaa
gccgattcagaaagtcgctcttcttcgccagacaggagaagacggcggaggaggaggaga
aggagacacaggagctgcagaagcagtgatgcaggcccctcccacagtgtccaggaggag
gaaaatgaaggagaaacagaggatgaagaggaggaggacgatcgaaggaagaggaggagg
tcagacagctactccttgacctttgatgaaagcttgtcctggtgtgtgattggtggactg
gggagagtgcgggatttacagagcagccaatcatcagacacgcacagcacgtccgcacag
tcagaggttacgatcccaggccccgagtcagattgtgacaacttcagtgtggagtttgaa
gtggagtccatcgattcagatgattacaacgaggatgatgcatcggtgtcagctgatgat
caggtttatgaagttaccatctttgaggccgatgatgaagacgactcctttgatgaagac
acagagatcaccgaagccgattactggaggtgtgtaaagtgcgacgaactaaatcctcct
cttcccagaaactgtctgcgctgctggactctgaggcgggattggctgccagaagagtcc
aggggtttggataacacctccccttactggcataaagccctgcccacaaagccatccagc
caatcagcagccaaagaagctgcagaagcttatgacgtggaggaacatgaaggaatggac
gttccagatggaaaaagagcaaaaactccttcatcacagcacctctcagactccaacccc
tcctcagctccctgctcccaggatctcctctgctcctctcagccctcctcgtcctcttac
tcctcctcctttgactcccaggagctgctccagttgtcgaacaccacgtcgcctcagcct
tcaactccagcctccagcaccagcgttccagagctggagcgcagctcgtcagcagaatgg
cgactcccggactcctgtctggacccgtgtctcatctgtcagtccaggccgaagaacggc
tgcatcgtccacggacgaacgggtcacctgatgtcctgctacgtctgcgccaggaagcta
aagaagagaaacaagctgtgcccggtctgcaggctgcccattcagtctgtggtcctcacc
tacatcagctga

DBGET integrated database retrieval system