KEGG   Cynoglossus semilaevis (tongue sole): 103382827
Entry
103382827         CDS       T04866                                 

Definition
(RefSeq) uncharacterized protein LOC103382827 isoform X1
  KO
K05461  KIT ligand
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem04010  MAPK signaling pathway
csem04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:csem00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103382827
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    103382827
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:csem04052]
    103382827
Cytokines and growth factors [BR:csem04052]
 Growth factors
  Growth factors (RTK binding)
   103382827
SSDB
Motif
Pfam: SCF
Other DBs
NCBI-GeneID: 103382827
NCBI-ProteinID: XP_008313978
UniProt: A0A3P8VQ49
LinkDB
Position
8
AA seq 273 aa
MDYQLYLLCNCCIYLYILLFLLQILTTPCLLLSLFTSLNLCSGKFGTPITDDVSKLTLLK
QNIPSDYEIPVSYIPKEVADTCWVVLNIYPLEQSLRKLANMFGTISSNKENIIVFIAMLK
SLRFTFDHEELETSMQVFQCHYQEGSLMSGLYFDYIKEVLQAAAQETAANFSCKPPPCLN
SQQTPGGLEDTRTSNWTKRMPLLLVLIPFTAAVVLIVWLVKSRRRLPPCSSENSQATPSD
MVPSVSVSIPLQTLAHAADTQPAGEAIPEDESG
NT seq 822 nt   +upstreamnt  +downstreamnt
atggattatcagctttacctgctctgtaactgttgtatatatttatatattttattgttt
ttgcttcagatcttgacaacaccttgtctcttactgagtctcttcaccagtctgaatctc
tgctctgggaaatttgggacgcccataactgatgatgtgagcaagctgacgctgctgaag
cagaatatcccctctgattatgaaattcctgttagttacattcccaaagaagtggctgac
acctgctgggtggtgctaaatatttatcccctggagcagagtcttcgtaagctggccaat
atgtttggcaccatctcctccaacaaagaaaacatcatcgtcttcatcgccatgttgaag
agcttacgcttcacttttgatcacgaggaactggaaacgtccatgcaggtcttccagtgt
cattaccaggaagggagcctcatgtctggcctttatttcgactacatcaaagaggtctta
caggctgcagctcaggagacggccgcaaacttctcgtgcaagccgccgccttgtcttaat
tctcaacaaacaccaggaggtctggaggacactcggacgtccaactggaccaagagaatg
cctttgcttctggttctgatcccattcacagccgccgtggttctcattgtgtggctggtg
aagtccaggagacgtttaccgccgtgcagctctgaaaatagccaagcgacaccttctgac
atggttccgagtgtgtctgtctccattccacttcagacactcgcccacgctgcagacact
cagccagcgggggaggccatccctgaggatgaaagtggatga

DBGET integrated database retrieval system