KEGG   Cynoglossus semilaevis (tongue sole): 103383026Help
Entry
103383026         CDS       T04866                                 

Gene name
gys2
Definition
(RefSeq) glycogen [starch] synthase, liver
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem00500  Starch and sucrose metabolism
csem01100  Metabolic pathways
csem04910  Insulin signaling pathway
Module
csem_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:csem00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    103383026 (gys2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    103383026 (gys2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:csem01003]
    103383026 (gys2)
Enzymes [BR:csem01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     103383026 (gys2)
Glycosyltransferases [BR:csem01003]
 Polysaccharide
  Storage polysaccharide
   103383026 (gys2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glyco_transf_5 Glyco_transf_4 Glycos_transf_1 Glyco_trans_1_4
Motif
Other DBs
NCBI-GeneID: 103383026
NCBI-ProteinID: XP_008314246
LinkDB All DBs
Position
8
AA seq 706 aa AA seqDB search
MPLPRSLSMTSLSGVLPAWEEDELPVEDLLLFEVSWEVTNKVGGIYTVIQTKAKITVDEW
GENYYMMGPYFEHNFKTQVEACEPPNPAIRKAMDSLIFSGCQVHFGRWLIEGSPYVILFD
LGSAAWNLDRWKGDLWQTCHIGLPYDDREANECLMLGSLVAWFFKELTDNLGEKPNVICH
YHEWQAGPGLIFSRCRKLPIATVFTTHATLLGRYLCAGNADFYNNLDKFNNDLEAGERQI
YHRYCLERAAVHCAHVFTTVSEITAVEAQHILHRRPDVVTPNGLNVKKFSAMHEFQNMHS
TSKARIQEFIRGHFYGHLDFNLDKTLFFFIAGRYEFSNKGADIFLEALSRLNYLLQVHKS
DVTVVGFFIMPAKTNNFNVESLKGQAVRKQLWDTAHTVKEKFGKKLYDALLKGSIPDMNS
ILERDDVTLMKRAIFATQQRQSLPPVTTHNMLDDSTDPILTNIRRIGLFNLRSDRVKIIF
HPEFLSSTSPLLPMDYEDFVRGCNLGVFPSYYEPWGYTPGECTVMGIPSVTTNLSGFGCF
MEEHVSDPTAYGIYIVDRRFRSAEESCKQLTQYMFSFCQQSRRQRIIQRNRTERLSELLD
WKYLGRFYVHARLLALSRAFPEKFKTEPIVSLKTEGFRYPRPYSVPPSPSASLHSTPHHS
DDEDDNDDDDDDDEHYDEDEEAERDRINIKAPFVLGAAPDIEENHI
NT seq 2121 nt NT seq  +upstreamnt  +downstreamnt
atgccactaccacggtctttgtccatgacgtccctgagcggcgtgctgccggcctgggag
gaggacgagctccctgtggaggacctgctcctcttcgaggtgtcctgggaggtcaccaac
aaagttggaggaatctacaccgtgatccagaccaaggccaagatcacggtggacgagtgg
ggggagaactactacatgatggggccgtactttgaacacaacttcaagacacaggtggag
gcctgtgagccccccaaccctgccatcaggaaggccatggactctctgatcttcagtggc
tgccaggttcatttcggccgctggctaatagaaggcagcccctacgtcatcctgtttgac
ctcggctccgccgcctggaacttggaccggtggaagggtgacctgtggcagacctgccac
attggcctgccctacgatgaccgagaggccaacgagtgcctcatgttgggctccctggtg
gcctggttcttcaaagagctcacagacaaccttggagaaaaacccaacgtcatctgtcac
taccacgagtggcaggccggaccgggtctcatcttctcccgctgccggaagcttcctatt
gccacggttttcaccacacacgccacactgctgggacggtacctctgtgctgggaacgct
gacttttacaacaacttagacaagtttaacaatgacctggaggcaggcgagcgacagatc
taccaccgctactgcctggagagggcagcagtgcactgtgctcatgtctttaccacagtg
tcggaaatcactgcagtggaggcccagcacatactacacaggaggccagacgtggtcacc
ccgaacggactgaacgtgaagaagttctctgccatgcacgagttccaaaacatgcactcc
accagcaaggctcgcatccaggagttcatcagaggtcacttttacggtcacctcgacttc
aacctggacaaaacacttttctttttcatcgctggccgttacgagttttccaacaaggga
gcggatattttcctggaggctctttccagactgaactacctgctgcaggtccataagagt
gatgtcacggtggtgggcttcttcataatgcctgccaaaacgaacaacttcaacgtggag
tccttgaagggtcaggcagtacgtaaacagctctgggacacagctcacactgtgaaggag
aagtttgggaagaagctttacgatgctcttctaaaagggagtatccctgacatgaattca
atcctggaacgagatgacgttacgctaatgaagagagctatcttcgccactcagcagaga
caaagcctgcctccggtgaccacacacaacatgctggacgactccactgaccccatcctg
accaacatcagacgcatcggtctcttcaacctgaggagtgaccgtgtcaagatcatcttc
cacccggagttcttgtcctccaccagtcctctgctgcccatggactacgaggactttgtt
cgtggatgtaacctgggagtcttcccctcgtactatgagccgtggggctacacacctggt
gagtgtacagtcatgggtattcccagtgtgaccaccaacctctctgggtttggctgcttc
atggaggagcacgtgtcagaccccacggcttatgggatctacattgtggaccggcggttt
cgttctgctgaagagtcgtgtaaacagctgacgcagtacatgttcagtttctgtcagcag
tcgcggcgtcagcgcatcatccaacgcaaccgcacggagaggttgtctgagctgctggac
tggaaatacctcggccggttttacgtccacgcccgcctcctggctctgagcagagcgttc
cccgagaagttcaagacggagcccatcgtctccctcaagaccgagggtttccgttaccca
cgcccctactccgtgccgccctctccttcagcctccctccactctactcctcatcacagc
gatgatgaagacgacaacgacgatgacgatgatgacgatgagcactacgatgaagacgag
gaggcagagagggacaggatcaacatcaaggctccctttgtgctcggcgctgcgcccgac
atcgaggaaaatcatatctag

DBGET integrated database retrieval system