KEGG   Cynoglossus semilaevis (tongue sole): 103383231
Entry
103383231         CDS       T04866                                 

Definition
(RefSeq) lysophosphatidic acid receptor 2-like
  KO
K04291  lysophosphatidic acid receptor 2
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem04080  Neuroactive ligand-receptor interaction
csem04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:csem00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    103383231
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103383231
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:csem04030]
    103383231
G protein-coupled receptors [BR:csem04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    103383231
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4
Other DBs
NCBI-GeneID: 103383231
NCBI-ProteinID: XP_008314504
UniProt: A0A3P8X598
LinkDB
Position
9
AA seq 372 aa
MDTHTDDEEGCYYNRTVKFFYEKSGKNITDHWRTRDYAIVSLGMTVCFIVIFSNLLVIAA
IFKNKRFHFPIYYLLGNLACADLFSGISYLHLMFHTGPWTIKLSKYQWFVRQGLIDTSLT
ASVLNLLAVAVERHQTIFNMQLHSKMSTRRVFIIIVFIWLLAVIMGLVPTMGWHCLCDLP
SCSTMAPMYSRNYLVFWGVLNLLTFSIMVGIYTRIFIYVRRKSKQMSQHTSQMRLKETVL
NLMKTVFTILGCFVICWTPGLVVLLLDGLGCEKCQVLRYEKYCLVLAECNSFVNPIIYCF
RDKDMRRTFKQILCCVFRRGGGGSSDGASAHFTTLDQENHKSRRSAPAERSNGRPLICDG
AEDAHANSDNWN
NT seq 1119 nt   +upstreamnt  +downstreamnt
atggatacgcacacggacgacgaggagggatgctactacaaccgcaccgtcaagttcttc
tacgagaagagcggcaagaacatcaccgaccactggcgcacgcgtgactacgccatcgtc
agtttggggatgaccgtctgcttcatcgtcatcttttcaaaccttttggtcatcgcggct
atttttaagaacaaacgctttcacttccccatctactacctgttgggtaacctggcctgt
gccgacctcttctcaggtatctcctacctccacctgatgtttcacactggtccctggacc
atcaaactctccaagtaccagtggttcgtccgccagggtctgatagacaccagtctgacg
gcctccgtcctcaacctcctggctgtggccgtggaacgccaccagaccatcttcaacatg
cagctgcacagcaagatgagcacccgccgcgtcttcatcatcatcgtcttcatctggctg
ctggccgtaatcatgggtctggtgcccaccatgggctggcactgcctgtgcgacctgccc
agctgttccaccatggccccgatgtacagccgcaactacctggtgttctggggcgtcctc
aaccttctcaccttctccatcatggtcggcatctacacccgcatcttcatctacgtcagg
cgtaagagcaagcagatgtcgcagcacacgtcgcagatgagactgaaggagacggtgtta
aatctgatgaagaccgtcttcaccatcctgggctgtttcgtgatctgctggacgccgggt
ctggtcgttctgctgctggacggcctcggctgcgaaaagtgccaagtgctgcgctacgag
aagtactgcctggtgctggccgagtgcaactccttcgtcaaccccatcatctactgtttc
agagacaaggacatgaggaggaccttcaagcagatcctgtgctgcgtcttcagacgcggc
ggcggcggcagcagcgacggcgcctccgcccactttaccactctggatcaagagaatcat
aaatcccgtaggtccgctccggcagagaggagcaacgggaggcctctcatctgtgacggc
gctgaagacgcgcacgccaactccgacaactggaattaa

DBGET integrated database retrieval system