KEGG   Cynoglossus semilaevis (tongue sole): 103383270Help
Entry
103383270         CDS       T04866                                 

Definition
(RefSeq) lysosomal alpha-glucosidase-like
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem00052  Galactose metabolism
csem00500  Starch and sucrose metabolism
csem01100  Metabolic pathways
csem04142  Lysosome
Brite
KEGG Orthology (KO) [BR:csem00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    103383270
   00500 Starch and sucrose metabolism
    103383270
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    103383270
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:csem04147]
    103383270
Enzymes [BR:csem01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     103383270
Exosome [BR:csem04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   103383270
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2 Trefoil DUF5110
Motif
Other DBs
NCBI-GeneID: 103383270
NCBI-ProteinID: XP_016890415
LinkDB All DBs
Position
9
AA seq 883 aa AA seqDB search
MPVRVPGVLEEPEETSLLARPQSCSITPGLLVIGCLLLLLRLSWLVGTMFWLHSPHHHDS
LRPPPPPGQAPAPAPADGGLVVNDTKADLRRVACSLIPEACRFDCYPERGVVVTRQMCEA
RKCCFIPASSRLPSANNPSGRNGIPWCFYPSDFPSYSLVSINDTSVGQKGTLVREVRTYY
PGDVLTLGLEIRHETDTRLRVRITDPSTPRFEVPISVPTSTKKAESPDYVVDFSKEPFGL
VVKRRSTGAVLLNTTVAPLFYADQFLQFSSSLLTQFIYGLGEHRSTFLHDVHWNTLTMWA
RDVPPTEQTNLYGAHPFYLALEEGGTAHGFFLLNSNAMDVVLQPAPAVTWRTIGGILDFY
IFLGPDPGSVVEQYVDVIGRPAMPVYWALGYHLCRWGYNTSDSTWDVVKKMRNYGIPQDV
QWNEMDTRVWPGLTAYPDFSDEVTHEWWYESLQRFHDKVPFDGLWIDMNEPSNFLDGSTN
GCPSSSLEDPPYTPGILGGLLRAKTVCATAQQKQSVHYNMHSLYGLMEAKASASALKRIL
AKRPFVISRSTFPSQGVFSGHWLGDNRSQWKDLYTSIAGILTFNLLGIPLVGADICGFSE
ETEEELCVRWTQLGAFYPFTRNHNAIGMEPQDPTVFSPLARTAMKGALLLRYSLFPVLYT
LFHHANVHGHTVARPLMFEFPKDIKTYGIDKQFLWGKSLLVTPVLDPGVDYVNGYFPEGL
WFDFYTGDSVLSKGEEIQLHAPLDKINLHVREGSVLPTQAPNLTLWVSSGQPLHLVAALS
DDGSASGDLFWDDGQSLDTYESDKYAYIVFSVAQNVMTSQVLHSDEEATYITVESASFYG
LKEKPSRVLVNSQDALFTYTDNQVLHVQDLGINLSQNFTISWM
NT seq 2652 nt NT seq  +upstreamnt  +downstreamnt
atgccggtccgcgtcccgggggtgttggaagaacccgaggagacctcccttcttgcccga
ccgcagtcgtgctccatcaccccggggctgctggtcattggctgcctgctgctgctcctg
cgtttaagctggctggtgggcaccatgttctggctgcacagtcctcaccaccacgactcc
ctgagacctcctccaccgccgggccaggccccggccccggccccggcagacggcggtctg
gttgttaacgacactaaagctgatttgcgtcgtgtggcttgtagtttgattccggaagcc
tgtaggtttgactgttaccctgaacggggcgtggttgtgaccagacagatgtgcgaggca
agaaaatgctgcttcattcccgcctcctccagactcccctctgccaacaacccatctggg
aggaacggcatcccctggtgtttttatccgtcagacttcccctcttactctctcgtgtca
ataaatgacacatctgtggggcaaaaaggaacgctggtcagggaagtcagaacctactac
ccaggagacgtcctcactctgggtttggagataagacacgagacggacacaaggctacgt
gttaggatcaccgacccctccaccccacggtttgaagtccccatctctgtccccacctcc
accaagaaggctgagagtccagactacgtggtggacttttcaaaagagccttttggtctg
gttgtgaagaggaggtccactggagcggtgcttctgaacaccacggtggctcctctcttc
tacgccgatcagttccttcagttctcctcctctttgctcactcagttcatctacggcctg
ggagaacatcggtccacctttcttcatgacgtccactggaacacgctcaccatgtgggcc
agagacgtgcctcctacggaacaaaccaatttgtacggcgctcatccgttttacctcgcg
ttggaggaaggaggaactgcacacggcttttttcttctcaacagcaacgccatggatgtg
gttctccagccagctccagcagtcacctggagaaccatcggtgggatcctggacttttac
attttccttggtcctgatcctggttctgttgttgaacagtatgtggacgttataggccgc
ccagcgatgcccgtctactgggcgttagggtaccacctgtgtcgctggggttacaacacc
agcgactccacctgggatgttgttaagaaaatgaggaattatgggatacctcaggacgtc
cagtggaatgaaatggataccagggtgtggcctggtctgacggcgtacccagatttctct
gatgaggtcactcatgagtggtggtacgagagcctgcagaggttccacgacaaagtgccg
tttgatggattatggatcgacatgaacgaaccgtccaatttcctggacgggtcgaccaac
ggctgtccgtcaagcagccttgaagatcctccatacacacctggcattctgggaggtttg
ctgcgagccaaaacagtgtgtgccacggcccagcagaagcagtccgtccactacaacatg
cacagtctgtacggactcatggaggccaaggcctcggccagtgccctgaagaggattctg
gccaagaggccgtttgtcatctcccgctccaccttccccagtcagggcgtgttctcgggc
cactggctgggagacaacaggagtcagtggaaagacctgtacacgtccatagcaggcatc
ttgacctttaacctcctgggcatccctctggtgggagcagacatctgtggattcagtgag
gagacggaggaggagctgtgcgtgcgctggacgcaactcggcgctttctatcccttcaca
cgcaaccacaacgccatcggcatggagcctcaggatcccactgtgttcagtcctctggct
cggacagccatgaagggggcgctgctgctgagatattccctcttccccgtcctctacaca
ctctttcatcacgcaaacgtgcacggccacactgttgcacgtccactgatgtttgaattt
cctaaagatataaaaacgtatgggatcgacaaacagttcctgtgggggaagagtttgttg
gtgacgccggtgttggaccctggggtggattacgtgaacggctacttcccagaggggctg
tggttcgacttctacacaggtgattctgtgctcagcaaaggtgaagagattcaacttcac
gctcctctagataagatcaacctgcacgtgcgtgaaggatcagttttaccgacacaggcg
cccaacctgaccctgtgggtgagcagtggtcagccgctgcacctggtcgccgcgctctct
gacgacggttcagcctccggggatttgttctgggacgacggccagagtctggacacatac
gagagcgacaaatacgcctacatcgtcttcagtgtcgcccagaacgtgatgacctcccag
gtccttcacagtgacgaggaggccacgtacatcacggtggagtccgcctccttctatggg
ctgaaggagaagcccagcagagtcttggtgaactcccaggatgcactgttcacctacaca
gacaaccaggttctacatgttcaggatctcggcatcaacctcagtcagaacttcaccatc
agctggatgtga

DBGET integrated database retrieval system