KEGG   Cynoglossus semilaevis (tongue sole): 103384525
Entry
103384525         CDS       T04866                                 

Definition
(RefSeq) voltage-dependent L-type calcium channel subunit alpha-1D-like isoform X1
  KO
K04851  voltage-dependent calcium channel L type alpha-1D
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem04010  MAPK signaling pathway
csem04020  Calcium signaling pathway
csem04218  Cellular senescence
csem04260  Cardiac muscle contraction
csem04261  Adrenergic signaling in cardiomyocytes
csem04270  Vascular smooth muscle contraction
csem04530  Tight junction
csem04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:csem00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103384525
   04020 Calcium signaling pathway
    103384525
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    103384525
  09144 Cellular community - eukaryotes
   04530 Tight junction
    103384525
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    103384525
  09153 Circulatory system
   04260 Cardiac muscle contraction
    103384525
   04261 Adrenergic signaling in cardiomyocytes
    103384525
   04270 Vascular smooth muscle contraction
    103384525
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:csem04040]
    103384525
Ion channels [BR:csem04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   103384525
SSDB
Motif
Pfam: Ion_trans Ca_chan_IQ GPHH PKD_channel CAC1F_C Rer1
Other DBs
NCBI-GeneID: 103384525
NCBI-ProteinID: XP_016891239
LinkDB
Position
10
AA seq 1876 aa
MQEADEQSGGAQYASNRGTTSSMHTSGLWSEHHTHLHQLHSPGPLQAPASTGKPVGSSYG
LLGVNSGSASGVSPVLAWHAAINAARQAQGDAAKLETGSQPSVCTTGPAPVGSLAQRKRQ
QYAKSKKQGGSTNSRPPRALFCLTLNNPIRRACISLVEWKPFDIFILMSIFANCVALAIY
IPFPGDDSNSTNQELETVEYAFLIIFTVETFLKIIAYGLVMHQNSYVRNGWNLLDFGIVI
IGLFSVVLEMITKDSDSGGQSGGKPSGFDAKALRAFRVLRPLRLVSGVPSLQVVLNSIIK
AMVPLLHIALLVLFVIIIYAIIGLELFIGKMHATCYVVKTGALAEEEPTPCAVSGHGRHC
LLNTTVCREGWQGPNNGITNFDNFLFAMLTVFQCITMEGWTDVLYWMNDAMGFELPWVYF
VSLVIFGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAE
DIDPENDEEGDEEGKRNRVTLADLTEKKKGMFGWFTQSTETQASITETESVNTENHNEEE
DKSLCCGPLCQKITKSKCSRQWRRWNRFCRRKCRAAVKSVTFYWLVIILVFLNTLTIASE
HYNQPDWLTEVQDVANKVLLALFTLEMLVKMYSLGLQAYFVSLFNRFDCFVVCGGIIETI
LVELAIMSPLGISVFRCVRLLRIFKVTRHWASLSNLVASLLNSMKSIASLLLLLFLFIII
FSLLGMQLFGGKFNFDENVTKRSTFDNFPQALLTVFQILTGEDWNTVMYDGIMAYGGPAT
SGMMLSVYFIILFICGNYILLNVFLAIAVDNLADAESLNTAQKEEEEAKKRKNSAKEIST
EKKKVEMTEPSDGETKIPPDVNVEEDKELYSVVDSPVCGDGDDEELPEMPPGPRPQRLSE
LTIREKTLPIPEGSAFFIFSSTNPFRVFCHKLINHQIFTNLILVFIMLSSVSLAAEDPIR
NFSARNIILGYADYVFTSMFTFEILIKMTAFGAFLHKGAFCRNYFNLLDLLVVGVSLVSF
GIQSSAISVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIMIVTTLLQFMFA
CIGVQLFKGKFYRCSDDAKSSPEECKGTYILYSNGDAGLPTVKERIWYNSDFNFDNVLMA
MMALFTVSTFEGWPALLYKAIDSNRENMGPIYNYRVEISIFFIIYIIIIAFFMMNIFVGF
VIVTFQEQGEKEYKNCELDKNQRQCVEYALKARPLRRYIPKNRYQYKFWYVVNSTGFEYI
MFVLIILNTLCLAIQHHGESQMFNYAMDILNMVFTGVFTVEMIFKLIAFKPRGYVGDAWN
VFDALVVIGSVVDIILSQSAAIPVIQVIVEPGNTEDSARISITFFRLFRVMRLVKLLSRG
EGIRTLLWTFIKSFQALPYVALLIAMLFFIYAVIGMQVFGKIAMVDGSQINRNNNFQTFP
QAVLMLFRCATGEAWQEIMLACLPGKLCDSESDYNPGEEKTCGSGFAIIYFISFYMLCAF
LIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWSEYDPEAKGRIKHLDVVTLLRRIQ
PPLGFGKLCPHRVACKRLVAMNMPLNSDGTVMFNATLFALVRTALKIKTEGNLEQANEEL
RAVIKKIWKRTSMKLLDQVVPPAGDDEVTVGKFYATFLIQDYFRKFKRRKEQGLVGRRSW
ERYNTTLALQAGLRTLHDLGPEIRRAISCDLQEEGLVDANGEEEEVIYRRDGGLFGNHVN
HVVNNQQGTSYLTTVTQRPLQILNVSCSSSVEPIQTVRTSIRDKEGETELNSSPHQENHH
YHKNNYTQSNSTNNSSQIPSNANLNNANVHTVFSVTNGSQQSCLRRNHISCSKKNGSAPT
FSKGAHNKPWKSYATR
NT seq 5631 nt   +upstreamnt  +downstreamnt
atgcaagaagcagatgaacagtccggaggggctcaatatgccagcaatagagggacgact
tcctccatgcacacctcaggcctttggtcagaacaccacacccatctgcaccagctccat
tcaccaggcccactacaggctcctgccagtaccgggaagccggtgggctcttcttatggt
ctccttggggtcaacagtggctctgcctccggggtcagtccagtccttgcttggcatgct
gccattaacgcagcacgacaggcacaaggggacgctgcaaagctggaaacaggttcccag
ccttcagtttgcaccactggaccggctcctgtaggctcactggcccagaggaagagacag
cagtatgccaaaagcaaaaaacaaggaggatccaccaacagccggccacccagagctctg
ttctgcctcactcttaacaaccccatccgcagggcctgcatcagcctggtggagtggaaa
ccgtttgatatctttatactgatgtcaatttttgccaactgcgtggccttagccatctac
atccctttccctggagacgactccaactctaccaatcaagaactggaaacagtggaatat
gccttcctcattatttttaccgtagagacatttctgaagattattgcctacggcctggtc
atgcaccaaaactcctatgtcagaaatggctggaatctgctggactttggcatcgtcata
atcgggttgttcagtgttgttctagagatgataaccaaagattctgactctggtggacag
tctgggggcaagcctagtgggtttgatgccaaggcccttcgagcctttcgtgttctacga
ccgctccgccttgtgtctggagttcccagtctacaggtggttttaaactcaattattaaa
gccatggttcctctgcttcacatcgctctgctcgtcctcttcgtcatcatcatctacgcc
atcattggtctggaactcttcattggcaaaatgcacgctacatgctatgtggttaaaaca
ggtgctcttgctgaagaagagccaacgccatgtgcagtatcagggcacggccgtcattgc
ctgctcaacaccacagtctgcagggaaggatggcagggtcctaacaacggaatcaccaac
tttgacaatttcctgtttgccatgctgactgtgttccagtgcataaccatggagggctgg
accgatgtcctctactggatgaatgatgccatgggctttgagctaccttgggtttacttt
gtcagcttggtcatctttggatccttctttgttctgaacttggtcctgggggtactgagt
ggggaattttccaaggagagggaaaaggccaaggctcggggtgactttcagaagttgcgt
gagaagcagcagttggaggaagacctgaagggctacttggactggatcacccaggccgag
gacatcgaccctgagaacgacgaggaaggagatgaggaaggcaagcgcaatcgggtcaca
ctggctgacctcactgagaagaagaaagggatgtttggctggttcacccagtccacagag
actcaggcgagcataacagagacagagtccgtgaacacagagaaccacaatgaagaagaa
gacaaatccttgtgctgtggaccactgtgtcaaaaaattactaagtcaaagtgcagccgt
cagtggcgccgctggaatcgtttttgccgcaggaagtgtcgagcggctgtgaaatccgtg
accttttattggctggtcattatcttggtatttctcaacactctcaccatcgcctctgag
cattacaaccaaccagactggctgacggaagtacaagatgtggccaacaaagttctcctc
gctctgttcactctggagatgctggtgaaaatgtacagtctggggctgcaggcttacttc
gtgtctctgttcaatcgattcgactgttttgtggtgtgtggtggcatcattgagaccatc
ctggtggagctggccatcatgtctcctctgggcatctctgtgtttagatgtgtacgcctg
cttaggatctttaaagtcacacgtcactgggcgtctctcagtaacctggtggcctctctg
ctcaactccatgaagtccattgcatccctgctgctgctgctcttccttttcataattatc
ttctctctgctcggcatgcagctctttggggggaaatttaattttgatgagaatgtaacc
aagagaagcacgtttgataactttccacaggctctgctcaccgttttccagattttgaca
ggagaagactggaacaccgtgatgtatgatggtatcatggcgtacggtggtccagccacc
tctggaatgatgctcagcgtttacttcatcatcctcttcatctgtggaaactacatcctg
ctcaacgtcttcttggctattgcggttgacaacctggcagacgcagagagccttaacaca
gcacagaaggaggaagaggaggccaagaagaggaagaacagtgccaaggaaataagtaca
gaaaagaaaaaagttgaaatgacagaacccagcgatggagagactaagattccaccagat
gtcaacgtggaggaagacaaagaactgtattctgtggtggattctccagtgtgtggtgat
ggcgatgatgaggagcttccagaaatgcccccgggaccccggccccaaaggctgtctgaa
ctcaccatcagagaaaagactctacccatcccagagggcagtgccttctttatcttcagc
agcaccaacccatttcgtgttttctgccataaactgatcaaccaccagatcttcaccaac
ctcatcctggtcttcatcatgctcagctctgtctctctggctgccgaggatcccatccgt
aacttctctgcccgcaatattatcctaggctatgcagactatgtcttcactagtatgttt
acatttgagatccttattaagatgacagcatttggggcgttccttcataaaggagcattc
tgtagaaactactttaacctgttggacttgctggttgtcggtgtgtctctggtctccttt
gggattcagtcgtctgctatttctgtggtgaagattctccgtgttttgagggtccttcgt
cctctgagggccatcaacagagccaagggcctcaagcatgtggtccagtgtgtgtttgtg
gccatcaggaccatcgggaacatcatgatcgtcaccactctgctgcagtttatgttcgcc
tgcattggtgtgcagctctttaaggggaaattctacagatgctcagatgatgcaaagtcc
agcccagaggaatgcaagggcacatacattctctacagcaacggtgacgcaggcctgcca
acagtgaaggagaggatctggtacaacagtgacttcaactttgacaatgttctcatggcc
atgatggcccttttcaccgtctctacctttgagggctggcctgcattgttgtacaaggcc
atcgactccaacagagagaacatgggtccaatctacaactaccgtgtggagatctccatc
ttcttcatcatctacatcatcatcatcgccttcttcatgatgaacatctttgttggtttt
gtcattgtcaccttccaagagcagggggagaaggagtataagaactgtgagctggacaaa
aaccagcgacagtgtgtggaatatgcactaaaagctcgtcctcttcgtcgttacatcccc
aaaaatcgataccagtacaagttctggtatgtggtcaactccactggctttgagtacatc
atgtttgtcctcattatcctcaacactttgtgtctcgccattcagcaccacggggagtct
caaatgtttaactatgccatggacatcctcaacatggtcttcactggagtcttcactgtg
gagatgatcttcaaactcatcgcctttaaacccagaggctacgttggggacgcctggaac
gtcttcgatgctctggtggtgattggcagtgtagtggacatcatactcagccagtcggca
gccattcctgtcatccaggtgatagtggagccggggaacacagaagacagtgctcgcatc
tccatcaccttcttccgtttgttcagggtgatgcgattggtcaaactgctgagcagagga
gaaggaatcaggactctgctgtggaccttcatcaaatcctttcaggctcttccttatgtt
gctctcctcattgccatgctgttcttcatctatgctgtcataggaatgcaggtatttggg
aaaatagcaatggtggatggatcacaaatcaaccgcaacaacaactttcagactttcccc
caagctgtcctgatgttattcaggtgtgccacaggtgaggcctggcaggagatcatgctg
gcctgtctgcctgggaaactgtgtgactcagagtctgactacaaccctggagaggagaaa
acctgcggcagtggatttgccatcatctacttcatcagcttctacatgctgtgtgctttt
ctgatcatcaacctgtttgttgctgtgatcatggacaactttgactatctgacccgtgat
tggtctatactggggccacatcacctggatgagtttaaaaggatctggtctgaatatgat
cctgaagctaaagggagaataaagcatctggatgtggtgactctgctgaggagaatccag
cctcctctgggctttggtaaactctgcccacacagagttgcctgtaagcgtctggtggcg
atgaacatgcccctgaacagtgatgggactgtgatgtttaatgccactttgtttgctctg
gttcgcactgctctgaagatcaagacggaggggaatctggaacaagccaatgaggagctg
agagctgtgatcaagaagatctggaagagaaccagcatgaagcttctggatcaagtggtg
ccccccgcaggcgatgacgaggtaacagtggggaagttttatgccacattcctgatacag
gactacttcaggaagttcaaaagacgcaaagagcaaggtcttgtgggaagacgctcttgg
gagagatacaataccaccctggctctacaggctggcctgcgtacgctgcatgaccttgga
ccagagatacgtagagccatatcatgtgacctgcaggaggaggggctagtagatgctaat
ggggaggaagaggaagtgatctacaggcgtgatggcggtttgtttgggaaccatgtcaat
catgtcgtcaacaaccagcagggcacctcctacctaactactgtcacccagcgtcctcta
cagattttgaacgtctcctgcagctcctcagttgaacccatccagactgtgaggacgtcg
atcagggacaaagagggagagacagagctgaactcctcaccccatcaggaaaatcaccat
tatcataaaaataattacacccaatccaattccaccaacaattcatcgcaaataccctct
aacgccaaccttaacaatgccaacgtgcacactgttttttctgtgaccaacgggagccag
cagagttgcttgaggagaaaccatatttcctgtagcaaaaagaatggatctgcacccaca
ttcagcaaaggagcacacaacaaaccatggaagtcatacgcaacaaggtaa

KEGG   Cynoglossus semilaevis (tongue sole): 103385821
Entry
103385821         CDS       T04866                                 

Definition
(RefSeq) voltage-dependent L-type calcium channel subunit alpha-1D-like
  KO
K04851  voltage-dependent calcium channel L type alpha-1D
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem04010  MAPK signaling pathway
csem04020  Calcium signaling pathway
csem04218  Cellular senescence
csem04260  Cardiac muscle contraction
csem04261  Adrenergic signaling in cardiomyocytes
csem04270  Vascular smooth muscle contraction
csem04530  Tight junction
csem04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:csem00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103385821
   04020 Calcium signaling pathway
    103385821
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    103385821
  09144 Cellular community - eukaryotes
   04530 Tight junction
    103385821
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    103385821
  09153 Circulatory system
   04260 Cardiac muscle contraction
    103385821
   04261 Adrenergic signaling in cardiomyocytes
    103385821
   04270 Vascular smooth muscle contraction
    103385821
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:csem04040]
    103385821
Ion channels [BR:csem04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   103385821
SSDB
Motif
Pfam: Ion_trans CAC1F_C Ca_chan_IQ GPHH PKD_channel FAM176 TRAP_alpha
Other DBs
NCBI-GeneID: 103385821
NCBI-ProteinID: XP_016892098
LinkDB
Position
11
AA seq 2132 aa
MSANRPAPSPAPTSPEAPPAPAPDPAATPHAPPAQSAPASTAIPVGALAQKKRQQYAKSK
KQGSNANSRPPRALFCLNLNNPIRRACISLVEWKPFDIFILIAIFANCMALAVYVPFPED
DSNSTNHDLETVEYAFLIIFTIETFLKIIAYGLVMHQNAYVRNGWNMLDFVIVVIGLFSV
ALELLTKDDKEEVEGPQSHPSMHGHGGKPGGFDVKALRAFRVLRPLRLVSGVPSLQVVLN
SIIKAMVPLLHIALLVLFVIIIYAIIGLELFIGKMHATCYWSGTDVIAEEESAPCAISGH
GRQCPLNGSMCREGWQGPNNGITNFDNFLFAMLTVFQCITMEGWTDVLYWMNDAMGFELP
WVYFVSLVIFGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLMGYLDWI
TQAEDIDPEDEAEEGKRTRVTLADLTGKKKGMFGWFSQSSDTHASVPASETESVNTENQN
GEDEKTPCCGTLCQKISKSKFSRRWRRWNRFCRRKCRLAVKSVPFYWLVIILVFLNTLTI
SSEHYNQPMWLTQVQDVANKVLLAMFTCEMLVKMYSLGLQAYFVSLFNRFDCFVVCGGIT
ETILVEFEIMSPLGISVFRCVRLLRIFKVTRHWQSLSNLVASLLNSMKSIASLLLLLFLF
IIIFSLLGMQVFGGKFNFDETQTKRSTFDNFPQALLTVFQILTGEDWNAVMYDGIMAYGG
PSSSGMVVCFYFIILFICGNCILLTVFLAIAVDNLADAESLNTDDGDKKDDKADDEVQDK
EEEEEEEDIDDTAAEEEDPEVPSGPRPVISELVKKEKITPIPEGSAFFIFSSTNPVRVFC
HRLINHHIFTNLILVFIMLSSVSLAAEDPIRNFSARNIILGYFDYAFTAIFTVEIVLKIL
GYADYVFTSMFTFEIVLKMTTYGAFLHKGAFCRNYFNLLDLLVVGVSLVSFGIQSSAISV
VKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIMIVTTLLQFMFACIGVQLFKG
KFYRCTDEAKSNPEECKGTYIVYKDGDVNQPTMHKRVWHNSDFNFDNVLMAMMALFTVST
FEGWPALLYKAIDSNRENLGPIYNYRVEISIFFIIYIIIIAFFMMNIFVGFVIVTFQEQG
EKEYKNCELDKNQRQCVEYALKARPLRRYIPKNPYQYKFWYVVNSTGFEYIMFVLIMLNT
LCLAVQHHGQSATFNYVMDILNMVFTAVFTVEMVLKLIAFKPRHYFTDAWNTFDALIVVG
SVVDIAITEVNPTETPQVDEMGNTEDSARISITFFRLFRVMRLVKLLSRGEGIRTLLWTF
IKSFQALPYVALLIAMLFFIYAVIGMQVFGKIAMVDGSQINRNNNFQTFPQAVLLLFRCA
TGEAWQDIMLACMPGKLCDPESDYHPGEEMTCGSGFAVIYFITFYMLCAFLIINLFVAVI
MDNFDYLTRDWSILGPHHLDEFKRIWSEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCP
HRVACKRLVAMNMPLNSDGTVMFNATLFALVRTALKIKTEGNLEQANEELRAVIKKIWKR
TSMKLLDQVVPPAGDDEVTVGKFYATFLIQDYFRKFKKRKEDGLVGAHPSQNNTAIALQA
GLRTLHDIGPEIRRAISCDLQDDELVDFIPEEDEEIYRRNGGLFGNHLMNGGHPSSNGHQ
TNATQRPLQVQPPPHYAHMEEPVGRLSRANAMSQPNHHRHHHHHHHHNRHHNSYNKSPKS
TNINLNNANVSSLPNGGHHCYYDHAPPNGYPGLRNTSHDYDKSRTPQSQRRRYYETYVRS
QGGDGRLPTIRREEEFDEDRLSGEYYSGEEFYENDSMLSGERYPNSDAEYETPKGYHHPD
SYYDDDEQPLYRDSRRSPKRRMLPATPQGNRRPSFNFECLRRQSSQDELPHQRTALPLHL
MQHQVMAVAGLDSSRAHRLSPTRSTRSWATPPATPASKDQSPYYTPLIRVDHPQRESAAS
SQVSVRKSSWYTDDPEFSQKMYSPVHLQVPPEYYNQYYQKRGSATSLVEAVLISEGLGRF
AKDPKFVAATKHEIADACDMTIDEMESAASQLLNGGVTRGGNGLNVFPLLTPRDYELQDT
AAVSYSDEEPETEVRAPYEEDLADEMICITTL
NT seq 6399 nt   +upstreamnt  +downstreamnt
atgagcgccaacaggcccgccccctccccagctcccacctccccagaagcccctccggcc
cctgctccggacccggccgccacaccgcacgctccacctgctcagtccgccccggcgtcc
actgctatcccagtaggtgcgttggcacagaagaagcggcagcagtatgccaaaagcaaa
aaacagggcagcaatgctaacagcagaccaccaagggctctgttctgcctcaacctcaac
aaccccatacgcagggcctgcatcagcctggtggagtggaagccatttgatatctttata
ttaattgctatttttgccaactgtatggccttagctgtctacgtccccttccctgaagac
gattccaactccaccaaccacgatctggaaacagtagagtatgcgttcctcatcattttt
accattgagaccttcctgaagatcattgcctacggcctggtgatgcaccagaacgcgtac
gtgagaaacggatggaacatgctggattttgtcattgttgtcattggactcttcagtgtt
gctttggagcttttgaccaaagatgataaggaggaagtggagggacctcaaagccatccg
tcgatgcatggacacggaggaaaaccaggtggatttgatgttaaagcccttcgagccttc
cgtgtgctgcgacccctgcggctggtctcaggagtacccagtttacaggtggtgttaaac
tccatcattaaagccatggtccctctccttcacatcgccctgctggtcttgtttgtcatt
atcatctacgctattatcggcctggagcttttcattggcaaaatgcacgcaacctgctat
tggtctggaacagacgtgatagctgaggaggaatcggctccatgtgcgatctcaggtcac
gggcgccagtgccccctcaacggctccatgtgcagggagggttggcagggtcccaataac
ggcatcaccaactttgacaacttcctgtttgccatgttgacggtcttccagtgcatcacc
atggagggctggaccgacgtcttgtactggatgaatgatgctatgggctttgagcttccg
tgggtgtactttgtgagtcttgtgatcttcggctcctttttcgttcttaacctggtgttg
ggtgtgttgagcggagagttttccaaggagagagaaaaggccaaggcccgcggagacttc
cagaagctgcgtgagaagcagcagctggaggaggatctgatgggttacctggactggatc
acacaggcggaagacatcgaccctgaggacgaggccgaggagggcaaacgcacccgtgtg
actctggctgacctcactgggaagaagaaaggaatgtttgggtggttcagccagtcgtcc
gacactcatgcgagcgttccagccagtgaaactgagtctgtgaacacggagaatcagaac
ggggaggacgagaagacgccgtgctgcggaactctgtgtcaaaagatttcaaagtccaag
ttcagtcggcgctggcgccgctggaacaggttctgccgcaggaagtgccggttggcggtg
aaatcggtgcctttctattggctggtcatcatcttggtgttcctcaacacactcaccata
tcctcggaacattacaatcaacccatgtggttgacgcaagtccaggatgtggccaacaag
gtgctgctggccatgttcacctgtgagatgttggtgaagatgtacagtctgggtctgcag
gcctacttcgtctccttgttcaaccgattcgactgcttcgtggtgtgtggaggaattaca
gaaaccattctggtggagtttgaaatcatgtctcctctgggcatctccgtgttccgctgt
gtgcgtctgctgaggatcttcaaggtcacgcgccactggcagtcgctcagtaacctggtg
gcgtctctgctcaactccatgaagtccatcgcttccctgctgctgctgctcttcctcttc
atcatcatcttctccctcctggggatgcaggtgtttggtggaaagttcaactttgacgag
actcaaaccaagaggagcacttttgacaacttcccccaggccctcctcaccgtctttcag
atcctgacgggagaagactggaacgccgtcatgtacgatggaatcatggcctacggaggt
ccttcatccagcgggatggttgtgtgcttctacttcatcatcctctttatctgtggaaac
tgtatcctgctgaccgtcttcttggccatcgctgtggacaacctggcagatgccgagtct
ctgaacacagacgacggagacaagaaagatgacaaagcggacgatgaggtccaggacaag
gaggaggaggaggaggaggaggacattgacgacaccgcagcggaggaggaagatcctgaa
gttccctcggggcctcgacccgtcatctctgagctggtgaagaaggagaagatcactccc
atccctgaaggaagtgccttcttcatttttagcagcacaaacccggttcgtgtgttctgc
cacagactcatcaatcaccacatcttcaccaacctcatcctggtcttcatcatgctcagc
tccgtctcactcgctgccgaggatccgatccgaaacttttcagcgcgaaatattatactt
ggttactttgactatgctttcacggctatctttactgttgagatcgtgttgaagatccta
ggctatgcagattatgtcttcactagtatgtttacatttgagatcgtattgaagatgacc
acatatggagctttcctacataaaggagcgttctgtaggaattacttcaacctccttgac
ctgttggtggtcggggtctccctcgtctccttcggaattcagtcctcggccatctcagtg
gtgaagattcttagggtccttcgtgtccttcggcccctcagggccatcaacagggccaaa
ggcctgaagcatgtagtgcagtgtgtgtttgtggccatcagaaccatcggtaacatcatg
atcgtcaccactctgctccagttcatgttcgcctgcatcggcgtgcagctctttaagggg
aagttctaccgctgcacagatgaagccaagtccaaccctgaagagtgcaagggaacgtac
atcgtgtacaaggacggggacgtgaaccagccgaccatgcacaagagggtgtggcacaac
agtgacttcaacttcgacaacgtcctcatggccatgatggctttgttcacggtgtcgacc
tttgaaggctggcctgcgttgctgtacaaggccatcgactccaacagagagaatctgggt
ccaatttacaactaccgcgtggagatttccatcttcttcatcatctacatcatcatcatc
gcctttttcatgatgaacatcttcgtgggtttcgtgatcgtcacgttccaggaacaggga
gagaaagagtacaaaaactgtgaactcgacaagaaccagcgtcagtgtgttgaatacgct
ctgaaggctcgtcccctgaggaggtacatacccaagaacccgtaccagtacaagttctgg
tatgtggtgaactccactgggtttgagtacatcatgtttgtacttatcatgctcaacacg
ctctgcctggctgtgcagcaccacggacagtcggcgacgttcaactacgtcatggacatt
cttaacatggtcttcactgctgtcttcactgtggaaatggttctcaaactgatcgctttc
aaacccaggcactatttcactgatgcttggaacacatttgatgccttaattgttgttggt
agcgtcgttgacattgctatcactgaagtgaatccaacagagacacctcaggtggatgag
atggggaacacggaggacagcgcccgcatctccatcaccttctttcgtctgttccgtgtc
atgcggttggtgaagctcctcagcagaggggagggcatccgcacgctgctttggactttc
atcaaatccttccaagctctgccgtacgttgctctgctgatagccatgttgttcttcatc
tacgctgtgatcggcatgcaggtttttgggaagattgccatggtggatggatcacagatc
aacagaaacaacaacttccagaccttccctcaggccgtgctgcttcttttcaggtgtgcc
actggggaggcgtggcaggacatcatgttggcctgtatgccggggaaactgtgtgacccc
gagtctgactaccatccaggggaggagatgacctgcggcagtggatttgccgttatttat
tttatcaccttctacatgctctgcgccttcttgatcattaatttgtttgttgccgtcatc
atggacaactttgattatttgacccgtgattggtccattctcggtcctcaccaccttgat
gagtttaaaagaatttggtcagagtatgatccggaagccaaaggcagaatcaaacacctg
gatgttgtgaccctcctgcgacgtattcagcctcctcttggctttggaaaactctgtcct
cacagagtggcctgcaagaggctggtggccatgaacatgcccctgaacagcgacggaaca
gtcatgtttaacgccaccctgtttgcacttgtgcgaacggccctgaagatcaaaactgaa
ggtaatctagagcaggccaacgaagagctgcgagccgtcatcaagaaaatctggaagaga
accagtatgaagctcctggatcaagtggtgcccccagctggcgatgatgaggtaaccgtg
gggaagttctatgccaccttcctgatacaggactactttaggaaattcaagaaacgtaag
gaggacggcctggtgggcgctcacccctcacagaacaacacggccatcgccctgcaggct
ggcctccgcacgctgcatgatattgggcctgaaatacgccgagcgatatcatgtgacctg
caagatgacgagcttgtagactttattcccgaggaagacgaggaaatttataggcgcaac
ggcggactcttcgggaaccacctcatgaacggcggccatccgagctccaacggccaccag
accaacgccacgcagcgacccctgcaggtgcagcccccgcctcactacgcccacatggag
gagccggtgggacgcctgtctcgagccaacgccatgtcccaacccaaccaccatcgccac
caccaccaccaccaccatcacaaccgacaccacaactcctacaacaagtcgccgaaatct
acaaacatcaacctcaacaacgccaacgtgtccagtctgcccaacggaggtcaccactgc
tactacgatcacgcgcctcccaatggttacccaggtctacgcaacacctctcacgactac
gacaagtccaggactccacagagtcaaagaaggcgctactatgagacctatgttaggtcc
cagggtggagatggacgcctcccaaccatccggagggaggaggagtttgatgaagatcgt
ctctctggggagtattacagcggggaggagttttatgaaaatgacagcatgctgtctgga
gaaaggtatccgaacagcgatgctgagtacgagactcctaaaggttatcatcaccctgac
agttactacgacgacgatgagcagcccctgtacagggactcacggaggtcaccgaagaga
cggatgcttcctgccacgcctcaaggtaacaggaggccgtccttcaacttcgagtgtctg
cgcagacagagcagccaggacgagcttccacatcagcggaccgctctgccgctgcacctc
atgcagcaccaggtcatggctgtagcgggcctggactccagcagagcccaccgcctctcc
ccgacccgctccacccgctcctgggcgactcctcccgccaccccggccagtaaagaccag
tcgccgtactacacccccctcatacgagtggaccacccgcagagggagagcgccgccagc
agccaagtgtctgtgaggaagagctcgtggtacacggacgacccggagttctcccagaag
atgtactcaccggtccacctgcaggtgccacctgagtactacaaccagtactaccagaaa
agaggcagcgccaccagcctggtggaggcggtgttgatatctgagggtcttggaagattt
gccaaggatcccaaatttgtcgccgcaaccaagcacgaaatagccgacgcgtgcgacatg
acgatagacgagatggagagtgcggccagtcaactgctgaacggaggggtgacccggggc
ggcaacgggctcaacgtgtttcctctgttgactcccagagactacgagctgcaggacact
gctgcggtcagctacagcgacgaggagccagagacagaagtcagagctccttacgaggag
gacctggcagacgagatgatctgcatcacgactttatag

DBGET integrated database retrieval system