KEGG   Cynoglossus semilaevis (tongue sole): 103384618Help
Entry
103384618         CDS       T04866                                 

Gene name
pfkm
Definition
(RefSeq) ATP-dependent 6-phosphofructokinase, muscle type
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem00010  Glycolysis / Gluconeogenesis
csem00030  Pentose phosphate pathway
csem00051  Fructose and mannose metabolism
csem00052  Galactose metabolism
csem01100  Metabolic pathways
csem01200  Carbon metabolism
csem01230  Biosynthesis of amino acids
csem03018  RNA degradation
Module
csem_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:csem00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    103384618 (pfkm)
   00030 Pentose phosphate pathway
    103384618 (pfkm)
   00051 Fructose and mannose metabolism
    103384618 (pfkm)
   00052 Galactose metabolism
    103384618 (pfkm)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    103384618 (pfkm)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:csem01009]
    103384618 (pfkm)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:csem03019]
    103384618 (pfkm)
Enzymes [BR:csem01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     103384618 (pfkm)
Protein phosphatases and associated proteins [BR:csem01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     103384618 (pfkm)
Messenger RNA biogenesis [BR:csem03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     103384618 (pfkm)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 103384618
NCBI-ProteinID: XP_008316415
LinkDB All DBs
Position
10
AA seq 779 aa AA seqDB search
MSKAPPTTDPTKMGIGRAIAVLTSGGDAQGMNAAVRATVRVGIYTGAKVYFVHEGYQGLV
DGGENIRLATWESVSMMLQLGGTVIGSARCKDFRNREGRLKAALNLVKLGITNLCVIGGD
GSLTGANQFRTEWSGLLADLVKAGKITENDAKKSSHLNIVGMVGSIDNDFCGTDMTIGTD
SALHRIMEVVDAITTTAQSHQRTFILEVMGRHCGYLALVTALACGADWVFIPEMPPDEAW
EDHLCRRLANQRARGSRLNVIIVAEGAMSREGKAITSDQIKKLVTDRLGFDTRTTILGHV
QRGGTPSAFDRVLGSRMGVEAVMALLEATPDTPACVVSLSGNQAIRLPLMECVQVTKDVT
AAMAEGRFEDAIKLRGKSFENNWNTYKLLGHINPPETKSNINVAIMNIGAPCAGMNAAVR
AAVRMGIIQGHNMLAVHDGFDGLAQGQIEPITWNGVSGWTGKGGSVLGTKRTLPGKILEE
ISLNIAKYNIHALVIIGGFEAYVGGLELVQAREKYEEMCIPMVVIPATVSNNVPGSDFSI
GADTALNTITTTCDRIKQSAAGTKRRVFIVETMGGYCGYLATMAGLAAGADAAYIFEERF
NIKDLQVNVDHLVEKMKTTVKRGLILRNENSNANYTTDFIFNLYSEEGKGVFDCRKNVLG
HMQQGGTPTPFDRNFGTKMGAKSVIWLTDKLKECYRHGRIFANTTDSACVLGMRKRALTF
QPLTELKGDTDFEHRIPKTQWWLKIRPIMKILAKYDIKLDTSESADMEHVIKTKTLFAK
NT seq 2340 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaggctccaccgaccacggaccccacaaagatggggattggacgggccattgct
gtgctgacgtcagggggagatgcccaaggtatgaacgctgcagtgagagccacggtcaga
gtggggatttacactggagccaaagtctactttgttcatgagggctaccagggcctggtg
gacggaggtgaaaacatccgcctggccacatgggagagtgtgtccatgatgctgcagctg
ggaggaactgtaatcggcagcgcccgctgtaaggacttcaggaacagggaagggcgtttg
aaggcggccctcaacctggtgaagctgggcatcaccaatctgtgtgtgattggaggtgac
ggcagtctgacaggagccaaccagttcaggacggagtggagcggactgctggctgacctg
gtcaaagctggtaaaatcactgaaaatgatgccaagaaatcttcccacctgaacatcgtc
gggatggtgggttccatcgacaatgacttctgtggcactgacatgaccatcggtaccgac
tcggctctgcaccgaatcatggaggtggtggacgccatcactacaacggcacagagccat
cagaggacattcatcctggaggtgatgggcagacactgtgggtacctggccctggtcaca
gcgttggcctgtggcgctgactgggtgtttattccagaaatgccaccagatgaagcctgg
gaggaccatctgtgcaggaggctggcaaaccaaagggcgagaggttctcgtctgaacgtg
atcattgtcgctgagggcgcgatgtccagagaggggaaggcgattacatctgatcaaatt
aaaaagctggtgactgacagactgggcttcgacactcgtaccaccattcttggacacgtg
cagagaggtggcacgccctccgcctttgacagagtcctgggcagcaggatgggtgtggag
gcggtgatggcgctgctggaggccactccagacactccagcctgtgtggtcagcctgtca
gggaaccaggctatcagactgccactcatggagtgtgttcaagtgaccaaagatgtgacg
gctgccatggctgagggcagatttgaagatgctattaaactcaggggcaagagcttcgaa
aacaactggaacacttacaaactgctgggtcacatcaaccccccagagactaagagtaac
atcaacgtggccatcatgaacatcggggctccctgtgctggtatgaacgctgcggttcgt
gctgctgtcagaatgggaatcatccaaggtcacaacatgttggctgttcacgatggtttt
gatggcctggcccagggacagattgagcccattacctggaatggagtgagtggttggaca
ggaaaaggaggctcggtgttgggcaccaagagaactctgccaggcaaaattttggaggaa
atcagcctgaacatcgccaaatataacatccacgctttggtgatcattggtggatttgag
gcctacgttggaggtctggagctggttcaagccagagagaagtatgaagagatgtgcatt
cctatggtggtgatcccggccactgtctcaaacaacgtccccggctctgacttcagcatt
ggagctgacactgccctcaacaccatcaccacgacctgtgacaggatcaagcagtcggca
gcagggaccaagcgccgcgtttttatcgttgagactatgggtggatactgcggctacttg
gctaccatggctggtctggctgctggagctgatgctgcctacattttcgaggaaagattc
aacattaaagatctgcaggtgaatgtagaccatctggtggagaagatgaagacaacggtg
aagagaggtttgattctcaggaatgaaaattccaatgccaactacaccactgacttcatc
ttcaacttgtactcagaggagggcaaaggcgtctttgattgccgtaagaatgtcctcgga
cacatgcaacagggtggcactccaacgcccttcgacagaaactttggcacaaaaatgggt
gccaagtctgttatttggctgacagataagctgaaggagtgctacaggcatggtcgtata
tttgctaacacaaccgactctgcctgtgttctgggcatgaggaagagagcgctcaccttc
cagccactcactgagttgaagggagatacagattttgagcaccgcatccctaagacccag
tggtggctgaagataaggccaatcatgaagatcctggccaagtacgacatcaaactagat
acatctgaaagtgctgatatggagcatgtgatcaagacgaagactctgtttgcgaagtag

DBGET integrated database retrieval system