KEGG   Cynoglossus semilaevis (tongue sole): 103384713
Entry
103384713         CDS       T04866                                 

Gene name
ikbkg
Definition
(RefSeq) NF-kappa-B essential modulator isoform X1
  KO
K07210  inhibitor of nuclear factor kappa-B kinase subunit gamma
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem04010  MAPK signaling pathway
csem04210  Apoptosis
csem04620  Toll-like receptor signaling pathway
csem04621  NOD-like receptor signaling pathway
csem04622  RIG-I-like receptor signaling pathway
csem04623  Cytosolic DNA-sensing pathway
csem04625  C-type lectin receptor signaling pathway
csem04920  Adipocytokine signaling pathway
csem05132  Salmonella infection
csem05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:csem00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103384713 (ikbkg)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    103384713 (ikbkg)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103384713 (ikbkg)
   04621 NOD-like receptor signaling pathway
    103384713 (ikbkg)
   04622 RIG-I-like receptor signaling pathway
    103384713 (ikbkg)
   04623 Cytosolic DNA-sensing pathway
    103384713 (ikbkg)
   04625 C-type lectin receptor signaling pathway
    103384713 (ikbkg)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    103384713 (ikbkg)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103384713 (ikbkg)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    103384713 (ikbkg)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:csem01001]
    103384713 (ikbkg)
Protein kinases [BR:csem01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   103384713 (ikbkg)
SSDB
Motif
Pfam: CC2-LZ NEMO zf_C2H2_10 APC_N_CC
Other DBs
NCBI-GeneID: 103384713
NCBI-ProteinID: XP_008316552
UniProt: A0A3P8UY82
LinkDB
Position
10
AA seq 618 aa
MVQPQPDGPLQWDMSGEDSGGALRVPPELAANEVVTRLLGDNQQLREALRRSNLALRQRC
EEMEGWQQRTREEREFLSSRFQEARSLVERLAQENHSLKSMVNGPTSTNCSSSSYGCQTE
DLQGRPARNGPHDGPQTLDQREKKRVEEVDQHTQTTPPRSLGDATVHSSLSSTLPTPPAS
MSEVLGEFLGREYCQPVEGASDFLQLLKSHKEKLEEGMRELRRKNEELEREREEGEKEKE
WMRRCIDQLQSKLAQTQATFVSEEAVQHRSEAQHSSDSSSLAKLTEQLQATQGRYRELEE
KLDYLQKSSAQRDRTEALLKQKDKDCTQLAKDCEALKAQATSLLGELKERQSCLEKSEHD
RKILEEKLGNKLKPLQAAERELDQQRKQHHVAMDKLLLQTQSLEQALKTERHVVTEEKKK
LTQLQHAYTCLFRDYDSKLKSEGGDLSIRLEEAERALALKQDLIDKLKEEVEQQKGSLET
VPVLTAQAEIYKADFLAEREAREKLNQRKEELQDHLTQAMAEIDKLKQEATSRARMVEMK
MRHMEDFSPRASHIPPPQNVFPGPAFNTVPPAPSFRIPCLAPAGDPGAEDVPDLRCPKCQ
YQAPDMDTLQIHVMDCIQ
NT seq 1857 nt   +upstreamnt  +downstreamnt
atggtgcagcctcaacctgatggcccattgcagtgggacatgtctggagaggacagtgga
ggggcccttcgggtcccaccagaacttgctgccaatgaagtggtgaccagattgttaggt
gataaccagcagctgcgagaggccctaagaaggagtaaccttgccctccgtcagcgctgc
gaggagatggaaggatggcaacaaagaacaagagaagaaagagagtttcttagctcccgt
ttccaggaggcccggtccctggtagagagactggcccaagaaaaccactccttaaagagt
atggtaaatggaccaacctccaccaactgctcatcttctagttatggctgccagactgaa
gaccttcagggacgcccagccaggaacggtccacatgatggaccacagacactagaccaa
cgagagaagaagagagttgaagaagtggatcagcacactcagaccacaccccctcgcagc
ctgggtgatgccactgtgcatagctcgttgagtagcaccctccctactccccctgcctca
atgtcagaggtactgggggagtttttgggcagggaatactgtcagccggtggaaggtgca
agtgatttccttcagctgctgaagagccataaggaaaaactggaagaaggtatgagagag
ctgcggagaaagaatgaagagctggagagggagcgagaagaaggagagaaagagaaagag
tggatgagacgctgcattgaccagctacaatccaaactggcgcagacacaggcgaccttt
gttagtgaggaggctgttcagcatcgatcggaggctcaacactcctctgacagctctagt
ctggctaaacttacagagcagcttcaggccacacagggcaggtatcgggaactcgaggag
aaacttgattacctgcagaaaagttcagctcaacgtgacagaactgaagctctgctcaaa
caaaaggacaaggactgcactcagttggccaaggactgtgaggctttaaaagcccaggcg
acatccttacttggagagctgaaagagagacagagctgcttagaaaaaagtgagcatgac
cgcaaaattttggaggaaaaactgggtaataagctgaagcctctacaggctgcagaacga
gagctggatcagcagaggaaacagcatcacgtggctatggacaagctgctgctgcagacc
cagagcctggaacaagcgctaaagactgagcgtcatgtggtgacagaggaaaagaaaaag
ctgactcagctgcagcatgcctacacctgcctctttagagattatgattctaaactgaag
agtgagggaggagatctgtccatcagactggaggaggcagagcgagcacttgccctgaaa
caagatctgattgacaaactgaaggaagaggttgagcagcagaaaggttcactggagacg
gttcctgtcctcactgcacaggccgagatctacaaggcagatttcttagcagaacgagaa
gcaagagagaagctgaaccagaggaaggaggagctgcaggaccatctgacacaggccatg
gctgagattgacaaactcaaacaggaagccacatcacgtgcacgtatggtggaaatgaag
atgagacacatggaagacttttcaccacgggcttcacacattcctcctccacaaaatgtg
ttcccaggtccagcttttaacacagtgcctcctgccccctcattccgcatcccctgtttg
gctccagcgggtgatccaggagctgaagatgtgcctgatttacgttgtcccaaatgccag
taccaggccccagatatggacactctgcagatacatgtcatggactgcatacagtaa

DBGET integrated database retrieval system