KEGG   Cynoglossus semilaevis (tongue sole): 103384870
Entry
103384870         CDS       T04866                                 

Definition
(RefSeq) rho-related GTP-binding protein RhoA-C
  KO
K04513  Ras homolog gene family, member A
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem04144  Endocytosis
csem04150  mTOR signaling pathway
csem04270  Vascular smooth muscle contraction
csem04310  Wnt signaling pathway
csem04350  TGF-beta signaling pathway
csem04510  Focal adhesion
csem04520  Adherens junction
csem04530  Tight junction
csem04621  NOD-like receptor signaling pathway
csem04625  C-type lectin receptor signaling pathway
csem04810  Regulation of actin cytoskeleton
csem05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:csem00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    103384870
   04350 TGF-beta signaling pathway
    103384870
   04150 mTOR signaling pathway
    103384870
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    103384870
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103384870
   04520 Adherens junction
    103384870
   04530 Tight junction
    103384870
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103384870
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    103384870
   04625 C-type lectin receptor signaling pathway
    103384870
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    103384870
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103384870
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:csem04131]
    103384870
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:csem04147]
    103384870
   04031 GTP-binding proteins [BR:csem04031]
    103384870
Membrane trafficking [BR:csem04131]
 Endocytosis
  Lipid raft mediated endocytosis
   RhoA-dependent endocytosis
    103384870
Exosome [BR:csem04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   103384870
  Exosomal proteins of other body fluids (saliva and urine)
   103384870
  Exosomal proteins of colorectal cancer cells
   103384870
  Exosomal proteins of bladder cancer cells
   103384870
GTP-binding proteins [BR:csem04031]
 Small (monomeric) G-proteins
  Rho Family
   RhoA/B/C [OT]
    103384870
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU Gtr1_RagA SRPRB
Other DBs
NCBI-GeneID: 103384870
NCBI-ProteinID: XP_008316782
UniProt: A0A3P8V1C6
LinkDB
Position
10
AA seq 193 aa
MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT
AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD
LRNDEHTRRELAKMKQEPVKSEEARDMANRINAFGYLECSAKTKDGVREVFEMATRAALQ
AKRRGKKSPCVLL
NT seq 582 nt   +upstreamnt  +downstreamnt
atggctgcgatcagaaagaagctggtgatagtcggtgatggagcctgtggtaaaacctgt
ctcctcatagtcttcagtaaggatcagtttcctgaggtttatgtgcccactgtgtttgag
aactatgtggcagacattgaggtcgatggtaaacaggtggagctggctctgtgggacaca
gctggtcaggaggactacgaccgactgaggccactctcttatccggacacagatgtcatc
cttatgtgtttctccattgacagccctgatagtttagagaatattccagagaagtggact
cctgaggtcaagcatttttgccccaatgtgccaatcattctcgtgggaaacaagaaagat
ctacggaatgatgagcatacacgtcgagagttagccaagatgaagcaggaaccagtgaag
tctgaggaggctcgagacatggcaaaccgcatcaatgcctttggttacctggagtgctcg
gccaagacgaaggacggcgtgagagaggtgttcgaaatggccaccagggccgcgctgcag
gccaagagacgaggcaagaagagcccctgcgttcttctatag

KEGG   Cynoglossus semilaevis (tongue sole): 103385009
Entry
103385009         CDS       T04866                                 

Definition
(RefSeq) rho-related GTP-binding protein RhoA-B
  KO
K04513  Ras homolog gene family, member A
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem04144  Endocytosis
csem04150  mTOR signaling pathway
csem04270  Vascular smooth muscle contraction
csem04310  Wnt signaling pathway
csem04350  TGF-beta signaling pathway
csem04510  Focal adhesion
csem04520  Adherens junction
csem04530  Tight junction
csem04621  NOD-like receptor signaling pathway
csem04625  C-type lectin receptor signaling pathway
csem04810  Regulation of actin cytoskeleton
csem05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:csem00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    103385009
   04350 TGF-beta signaling pathway
    103385009
   04150 mTOR signaling pathway
    103385009
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    103385009
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103385009
   04520 Adherens junction
    103385009
   04530 Tight junction
    103385009
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103385009
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    103385009
   04625 C-type lectin receptor signaling pathway
    103385009
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    103385009
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103385009
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:csem04131]
    103385009
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:csem04147]
    103385009
   04031 GTP-binding proteins [BR:csem04031]
    103385009
Membrane trafficking [BR:csem04131]
 Endocytosis
  Lipid raft mediated endocytosis
   RhoA-dependent endocytosis
    103385009
Exosome [BR:csem04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   103385009
  Exosomal proteins of other body fluids (saliva and urine)
   103385009
  Exosomal proteins of colorectal cancer cells
   103385009
  Exosomal proteins of bladder cancer cells
   103385009
GTP-binding proteins [BR:csem04031]
 Small (monomeric) G-proteins
  Rho Family
   RhoA/B/C [OT]
    103385009
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU Gtr1_RagA SRPRB
Other DBs
NCBI-GeneID: 103385009
NCBI-ProteinID: XP_008316973
UniProt: A0A3P8V276
LinkDB
Position
10
AA seq 193 aa
MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSKQVELALWDT
AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD
LRNDEHTRRELAKMKQEPVKSEEGRDMAGRIAAFGYMECSAKTKDGVREVFEMATRAALQ
TRRGKKSSKCVLL
NT seq 582 nt   +upstreamnt  +downstreamnt
atggcagccatccgtaagaagctggtgattgtgggtgatggagcttgtggaaagacctgc
cttttaattgtctttagtaaggaccagttcccagaggtctacgttcccactgtttttgag
aactatgttgctgacatagaggtggacagcaaacaggttgagctggccctgtgggacaca
gcaggtcaggaggactacgacaggctgagacccctttcctacccagacactgatgtcatt
cttatgtgcttctccatagacagccccgacagcttggaaaacattccagagaagtggacc
ccagaagtcaaacacttctgccccaacgttcccattatccttgtcggtaacaagaaagac
ctgcgcaatgatgagcacacacgtcgagagctggccaagatgaagcaggagcctgtgaag
tcggaggagggccgggacatggccggaagaatcgcagcatttggttacatggaatgctct
gccaagacgaaggacggtgtgcgggaggtgtttgagatggccaccagggcagcactgcag
actcgtcgaggaaaaaagagcagcaaatgtgtactgctctaa

KEGG   Cynoglossus semilaevis (tongue sole): 103385834
Entry
103385834         CDS       T04866                                 

Definition
(RefSeq) transforming protein RhoA
  KO
K04513  Ras homolog gene family, member A
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem04144  Endocytosis
csem04150  mTOR signaling pathway
csem04270  Vascular smooth muscle contraction
csem04310  Wnt signaling pathway
csem04350  TGF-beta signaling pathway
csem04510  Focal adhesion
csem04520  Adherens junction
csem04530  Tight junction
csem04621  NOD-like receptor signaling pathway
csem04625  C-type lectin receptor signaling pathway
csem04810  Regulation of actin cytoskeleton
csem05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:csem00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    103385834
   04350 TGF-beta signaling pathway
    103385834
   04150 mTOR signaling pathway
    103385834
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    103385834
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103385834
   04520 Adherens junction
    103385834
   04530 Tight junction
    103385834
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103385834
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    103385834
   04625 C-type lectin receptor signaling pathway
    103385834
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    103385834
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103385834
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:csem04131]
    103385834
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:csem04147]
    103385834
   04031 GTP-binding proteins [BR:csem04031]
    103385834
Membrane trafficking [BR:csem04131]
 Endocytosis
  Lipid raft mediated endocytosis
   RhoA-dependent endocytosis
    103385834
Exosome [BR:csem04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   103385834
  Exosomal proteins of other body fluids (saliva and urine)
   103385834
  Exosomal proteins of colorectal cancer cells
   103385834
  Exosomal proteins of bladder cancer cells
   103385834
GTP-binding proteins [BR:csem04031]
 Small (monomeric) G-proteins
  Rho Family
   RhoA/B/C [OT]
    103385834
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU SRPRB Gtr1_RagA
Other DBs
NCBI-GeneID: 103385834
NCBI-ProteinID: XP_008318055
UniProt: A0A3P8URH2
LinkDB
Position
11
AA seq 193 aa
MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT
AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD
LRNDEHTRRELAKMKQEPVKPEDGRDMANRINAFGYMECSAKTKDGVREVFEMATRAALQ
ARRGKKSSKCALL
NT seq 582 nt   +upstreamnt  +downstreamnt
atggcagcaatcaggaaaaaactggttatagtgggagatggagcctgtggaaagacctgt
ctgctcatcgtgttcagtaaagaccagtttccagaggtctacgtgcccacagtcttcgag
aactatgttgctgacattgaagttgatggcaaacaggtggagttggccctgtgggatacc
gctggtcaagaagactacgacaggctgcgtccactctcctatccagacactgacgtcatt
ctcatgtgtttctccattgacagtcctgacagtcttgagaacatcccagaaaagtggacc
cctgaggtgaaacacttctgtcctaatgttcccattatactggtgggaaataagaaggat
ctgcgaaatgacgagcacacccggagggagctggccaaaatgaagcaggaacctgtgaag
ccagaagacgggcgggacatggcaaacaggatcaatgcctttggatacatggagtgttct
gcaaaaacaaaggatggtgtgagggaagtctttgagatggccaccagggctgcactacag
gccagacgaggaaagaagagcagtaaatgtgcccttctgtaa

KEGG   Cynoglossus semilaevis (tongue sole): 103386563
Entry
103386563         CDS       T04866                                 

Definition
(RefSeq) rho-related GTP-binding protein RhoA-D
  KO
K04513  Ras homolog gene family, member A
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem04144  Endocytosis
csem04150  mTOR signaling pathway
csem04270  Vascular smooth muscle contraction
csem04310  Wnt signaling pathway
csem04350  TGF-beta signaling pathway
csem04510  Focal adhesion
csem04520  Adherens junction
csem04530  Tight junction
csem04621  NOD-like receptor signaling pathway
csem04625  C-type lectin receptor signaling pathway
csem04810  Regulation of actin cytoskeleton
csem05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:csem00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    103386563
   04350 TGF-beta signaling pathway
    103386563
   04150 mTOR signaling pathway
    103386563
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    103386563
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103386563
   04520 Adherens junction
    103386563
   04530 Tight junction
    103386563
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103386563
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    103386563
   04625 C-type lectin receptor signaling pathway
    103386563
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    103386563
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103386563
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:csem04131]
    103386563
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:csem04147]
    103386563
   04031 GTP-binding proteins [BR:csem04031]
    103386563
Membrane trafficking [BR:csem04131]
 Endocytosis
  Lipid raft mediated endocytosis
   RhoA-dependent endocytosis
    103386563
Exosome [BR:csem04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   103386563
  Exosomal proteins of other body fluids (saliva and urine)
   103386563
  Exosomal proteins of colorectal cancer cells
   103386563
  Exosomal proteins of bladder cancer cells
   103386563
GTP-binding proteins [BR:csem04031]
 Small (monomeric) G-proteins
  Rho Family
   RhoA/B/C [OT]
    103386563
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU Gtr1_RagA SRPRB
Other DBs
NCBI-GeneID: 103386563
NCBI-ProteinID: XP_008319114
UniProt: A0A3P8WEL8
LinkDB
Position
11
AA seq 193 aa
MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYIADIEVDGKQVELALWDT
AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD
LRNDEHTRRELAKMKQEPVKTEEGRDMAGRINAFGYLECSAKTKDGVREVFEMATRAALQ
VRKRKKRSGCTLL
NT seq 582 nt   +upstreamnt  +downstreamnt
atggcagccatcaggaagaagttggtgattgtcggtgatggagcgtgtggaaaaacctgt
ctcctgattgttttcagtaaagaccagtttcccgaagtctacgtgcccacggtgtttgag
aactacatcgctgacatcgaggttgacggaaaacaggtggagttggccctgtgggatact
gcaggtcaggaggactacgacaggttgaggcctctctcgtacccagacacggatgtcatc
ctgatgtgtttctccatcgacagccctgacagtttagaaaacatccctgagaagtggaca
cctgaggtgaaacacttctgtcccaacgttcccatcattctggtggggaacaagaaggac
ctgaggaacgacgagcacacacggagagagctggccaagatgaagcaggaaccagtgaag
acggaggaaggcagagacatggccggcagaatcaacgcctttggctatctggaatgttcc
gccaagaccaaggatggtgtacgggaggtgtttgagatggccaccagggcggcgctgcag
gtgcgcaagcgcaagaagaggagtggttgcacgttgctgtaa

DBGET integrated database retrieval system