Cynoglossus semilaevis (tongue sole): 103384870 Help Entry 103384870         CDS       T04866                                  Definition (RefSeq) rho-related GTP-binding protein RhoA-C   KO K04513   Ras homolog gene family, member A Organism csem  Cynoglossus semilaevis (tongue sole) Pathway csem04144   Endocytosis csem04150   mTOR signaling pathway csem04270   Vascular smooth muscle contraction csem04310   Wnt signaling pathway csem04350   TGF-beta signaling pathway csem04510   Focal adhesion csem04520   Adherens junction csem04530   Tight junction csem04621   NOD-like receptor signaling pathway csem04625   C-type lectin receptor signaling pathway csem04810   Regulation of actin cytoskeleton csem05132   Salmonella infection Brite KEGG Orthology (KO) [BR:csem00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     103384870    04350 TGF-beta signaling pathway     103384870    04150 mTOR signaling pathway     103384870  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     103384870   09144 Cellular community - eukaryotes    04510 Focal adhesion     103384870    04520 Adherens junction     103384870    04530 Tight junction     103384870   09142 Cell motility    04810 Regulation of actin cytoskeleton     103384870  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     103384870    04625 C-type lectin receptor signaling pathway     103384870   09153 Circulatory system    04270 Vascular smooth muscle contraction     103384870  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     103384870  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:csem04131]     103384870   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:csem04147]     103384870    04031 GTP-binding proteins [BR:csem04031]     103384870 Membrane trafficking [BR:csem04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     103384870 Exosome [BR:csem04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    103384870   Exosomal proteins of other body fluids (saliva and urine)    103384870   Exosomal proteins of colorectal cancer cells    103384870   Exosomal proteins of bladder cancer cells    103384870 GTP-binding proteins [BR:csem04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     103384870 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA SRPRB Motif Other DBs NCBI-GeneID:  103384870 NCBI-ProteinID:  XP_008316782 UniProt:  A0A3P8V1C6 LinkDB All DBs Position 10 AA seq 193 aa AA seqDB search MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD LRNDEHTRRELAKMKQEPVKSEEARDMANRINAFGYLECSAKTKDGVREVFEMATRAALQ AKRRGKKSPCVLL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggctgcgatcagaaagaagctggtgatagtcggtgatggagcctgtggtaaaacctgt ctcctcatagtcttcagtaaggatcagtttcctgaggtttatgtgcccactgtgtttgag aactatgtggcagacattgaggtcgatggtaaacaggtggagctggctctgtgggacaca gctggtcaggaggactacgaccgactgaggccactctcttatccggacacagatgtcatc cttatgtgtttctccattgacagccctgatagtttagagaatattccagagaagtggact cctgaggtcaagcatttttgccccaatgtgccaatcattctcgtgggaaacaagaaagat ctacggaatgatgagcatacacgtcgagagttagccaagatgaagcaggaaccagtgaag tctgaggaggctcgagacatggcaaaccgcatcaatgcctttggttacctggagtgctcg gccaagacgaaggacggcgtgagagaggtgttcgaaatggccaccagggccgcgctgcag gccaagagacgaggcaagaagagcccctgcgttcttctatag

Cynoglossus semilaevis (tongue sole): 103385009 Help Entry 103385009         CDS       T04866                                  Definition (RefSeq) rho-related GTP-binding protein RhoA-B   KO K04513   Ras homolog gene family, member A Organism csem  Cynoglossus semilaevis (tongue sole) Pathway csem04144   Endocytosis csem04150   mTOR signaling pathway csem04270   Vascular smooth muscle contraction csem04310   Wnt signaling pathway csem04350   TGF-beta signaling pathway csem04510   Focal adhesion csem04520   Adherens junction csem04530   Tight junction csem04621   NOD-like receptor signaling pathway csem04625   C-type lectin receptor signaling pathway csem04810   Regulation of actin cytoskeleton csem05132   Salmonella infection Brite KEGG Orthology (KO) [BR:csem00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     103385009    04350 TGF-beta signaling pathway     103385009    04150 mTOR signaling pathway     103385009  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     103385009   09144 Cellular community - eukaryotes    04510 Focal adhesion     103385009    04520 Adherens junction     103385009    04530 Tight junction     103385009   09142 Cell motility    04810 Regulation of actin cytoskeleton     103385009  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     103385009    04625 C-type lectin receptor signaling pathway     103385009   09153 Circulatory system    04270 Vascular smooth muscle contraction     103385009  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     103385009  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:csem04131]     103385009   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:csem04147]     103385009    04031 GTP-binding proteins [BR:csem04031]     103385009 Membrane trafficking [BR:csem04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     103385009 Exosome [BR:csem04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    103385009   Exosomal proteins of other body fluids (saliva and urine)    103385009   Exosomal proteins of colorectal cancer cells    103385009   Exosomal proteins of bladder cancer cells    103385009 GTP-binding proteins [BR:csem04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     103385009 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA SRPRB Motif Other DBs NCBI-GeneID:  103385009 NCBI-ProteinID:  XP_008316973 UniProt:  A0A3P8V276 LinkDB All DBs Position 10 AA seq 193 aa AA seqDB search MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSKQVELALWDT AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD LRNDEHTRRELAKMKQEPVKSEEGRDMAGRIAAFGYMECSAKTKDGVREVFEMATRAALQ TRRGKKSSKCVLL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggcagccatccgtaagaagctggtgattgtgggtgatggagcttgtggaaagacctgc cttttaattgtctttagtaaggaccagttcccagaggtctacgttcccactgtttttgag aactatgttgctgacatagaggtggacagcaaacaggttgagctggccctgtgggacaca gcaggtcaggaggactacgacaggctgagacccctttcctacccagacactgatgtcatt cttatgtgcttctccatagacagccccgacagcttggaaaacattccagagaagtggacc ccagaagtcaaacacttctgccccaacgttcccattatccttgtcggtaacaagaaagac ctgcgcaatgatgagcacacacgtcgagagctggccaagatgaagcaggagcctgtgaag tcggaggagggccgggacatggccggaagaatcgcagcatttggttacatggaatgctct gccaagacgaaggacggtgtgcgggaggtgtttgagatggccaccagggcagcactgcag actcgtcgaggaaaaaagagcagcaaatgtgtactgctctaa

Cynoglossus semilaevis (tongue sole): 103385834 Help Entry 103385834         CDS       T04866                                  Definition (RefSeq) transforming protein RhoA   KO K04513   Ras homolog gene family, member A Organism csem  Cynoglossus semilaevis (tongue sole) Pathway csem04144   Endocytosis csem04150   mTOR signaling pathway csem04270   Vascular smooth muscle contraction csem04310   Wnt signaling pathway csem04350   TGF-beta signaling pathway csem04510   Focal adhesion csem04520   Adherens junction csem04530   Tight junction csem04621   NOD-like receptor signaling pathway csem04625   C-type lectin receptor signaling pathway csem04810   Regulation of actin cytoskeleton csem05132   Salmonella infection Brite KEGG Orthology (KO) [BR:csem00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     103385834    04350 TGF-beta signaling pathway     103385834    04150 mTOR signaling pathway     103385834  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     103385834   09144 Cellular community - eukaryotes    04510 Focal adhesion     103385834    04520 Adherens junction     103385834    04530 Tight junction     103385834   09142 Cell motility    04810 Regulation of actin cytoskeleton     103385834  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     103385834    04625 C-type lectin receptor signaling pathway     103385834   09153 Circulatory system    04270 Vascular smooth muscle contraction     103385834  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     103385834  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:csem04131]     103385834   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:csem04147]     103385834    04031 GTP-binding proteins [BR:csem04031]     103385834 Membrane trafficking [BR:csem04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     103385834 Exosome [BR:csem04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    103385834   Exosomal proteins of other body fluids (saliva and urine)    103385834   Exosomal proteins of colorectal cancer cells    103385834   Exosomal proteins of bladder cancer cells    103385834 GTP-binding proteins [BR:csem04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     103385834 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU SRPRB Gtr1_RagA Motif Other DBs NCBI-GeneID:  103385834 NCBI-ProteinID:  XP_008318055 UniProt:  A0A3P8URH2 LinkDB All DBs Position 11 AA seq 193 aa AA seqDB search MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD LRNDEHTRRELAKMKQEPVKPEDGRDMANRINAFGYMECSAKTKDGVREVFEMATRAALQ ARRGKKSSKCALL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggcagcaatcaggaaaaaactggttatagtgggagatggagcctgtggaaagacctgt ctgctcatcgtgttcagtaaagaccagtttccagaggtctacgtgcccacagtcttcgag aactatgttgctgacattgaagttgatggcaaacaggtggagttggccctgtgggatacc gctggtcaagaagactacgacaggctgcgtccactctcctatccagacactgacgtcatt ctcatgtgtttctccattgacagtcctgacagtcttgagaacatcccagaaaagtggacc cctgaggtgaaacacttctgtcctaatgttcccattatactggtgggaaataagaaggat ctgcgaaatgacgagcacacccggagggagctggccaaaatgaagcaggaacctgtgaag ccagaagacgggcgggacatggcaaacaggatcaatgcctttggatacatggagtgttct gcaaaaacaaaggatggtgtgagggaagtctttgagatggccaccagggctgcactacag gccagacgaggaaagaagagcagtaaatgtgcccttctgtaa

Cynoglossus semilaevis (tongue sole): 103386563 Help Entry 103386563         CDS       T04866                                  Definition (RefSeq) rho-related GTP-binding protein RhoA-D   KO K04513   Ras homolog gene family, member A Organism csem  Cynoglossus semilaevis (tongue sole) Pathway csem04144   Endocytosis csem04150   mTOR signaling pathway csem04270   Vascular smooth muscle contraction csem04310   Wnt signaling pathway csem04350   TGF-beta signaling pathway csem04510   Focal adhesion csem04520   Adherens junction csem04530   Tight junction csem04621   NOD-like receptor signaling pathway csem04625   C-type lectin receptor signaling pathway csem04810   Regulation of actin cytoskeleton csem05132   Salmonella infection Brite KEGG Orthology (KO) [BR:csem00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     103386563    04350 TGF-beta signaling pathway     103386563    04150 mTOR signaling pathway     103386563  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     103386563   09144 Cellular community - eukaryotes    04510 Focal adhesion     103386563    04520 Adherens junction     103386563    04530 Tight junction     103386563   09142 Cell motility    04810 Regulation of actin cytoskeleton     103386563  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     103386563    04625 C-type lectin receptor signaling pathway     103386563   09153 Circulatory system    04270 Vascular smooth muscle contraction     103386563  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     103386563  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:csem04131]     103386563   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:csem04147]     103386563    04031 GTP-binding proteins [BR:csem04031]     103386563 Membrane trafficking [BR:csem04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     103386563 Exosome [BR:csem04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    103386563   Exosomal proteins of other body fluids (saliva and urine)    103386563   Exosomal proteins of colorectal cancer cells    103386563   Exosomal proteins of bladder cancer cells    103386563 GTP-binding proteins [BR:csem04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     103386563 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA SRPRB Motif Other DBs NCBI-GeneID:  103386563 NCBI-ProteinID:  XP_008319114 UniProt:  A0A3P8WEL8 LinkDB All DBs Position 11 AA seq 193 aa AA seqDB search MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYIADIEVDGKQVELALWDT AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD LRNDEHTRRELAKMKQEPVKTEEGRDMAGRINAFGYLECSAKTKDGVREVFEMATRAALQ VRKRKKRSGCTLL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggcagccatcaggaagaagttggtgattgtcggtgatggagcgtgtggaaaaacctgt ctcctgattgttttcagtaaagaccagtttcccgaagtctacgtgcccacggtgtttgag aactacatcgctgacatcgaggttgacggaaaacaggtggagttggccctgtgggatact gcaggtcaggaggactacgacaggttgaggcctctctcgtacccagacacggatgtcatc ctgatgtgtttctccatcgacagccctgacagtttagaaaacatccctgagaagtggaca cctgaggtgaaacacttctgtcccaacgttcccatcattctggtggggaacaagaaggac ctgaggaacgacgagcacacacggagagagctggccaagatgaagcaggaaccagtgaag acggaggaaggcagagacatggccggcagaatcaacgcctttggctatctggaatgttcc gccaagaccaaggatggtgtacgggaggtgtttgagatggccaccagggcggcgctgcag gtgcgcaagcgcaagaagaggagtggttgcacgttgctgtaa

DBGET integrated database retrieval system