KEGG   Cynoglossus semilaevis (tongue sole): 103385629
Entry
103385629         CDS       T04866                                 

Definition
(RefSeq) putative transcription factor p65 homolog
  KO
K04735  transcription factor p65
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem04010  MAPK signaling pathway
csem04137  Mitophagy - animal
csem04210  Apoptosis
csem04218  Cellular senescence
csem04620  Toll-like receptor signaling pathway
csem04621  NOD-like receptor signaling pathway
csem04622  RIG-I-like receptor signaling pathway
csem04623  Cytosolic DNA-sensing pathway
csem04625  C-type lectin receptor signaling pathway
csem04920  Adipocytokine signaling pathway
csem05132  Salmonella infection
csem05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:csem00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103385629
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    103385629
  09143 Cell growth and death
   04210 Apoptosis
    103385629
   04218 Cellular senescence
    103385629
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103385629
   04621 NOD-like receptor signaling pathway
    103385629
   04622 RIG-I-like receptor signaling pathway
    103385629
   04623 Cytosolic DNA-sensing pathway
    103385629
   04625 C-type lectin receptor signaling pathway
    103385629
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    103385629
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103385629
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    103385629
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:csem03000]
    103385629
Transcription factors [BR:csem03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    103385629
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer
Other DBs
NCBI-GeneID: 103385629
NCBI-ProteinID: XP_008317791
UniProt: A0A3P8WZA2
LinkDB
Position
1
AA seq 603 aa
MDGVYGWGLTPLNQVQTTPYIEIIEQPKQRGMRFRYKCEGRSAGSIPGEKSNDTTKTHPA
IKVHNYSGPLRVRISLVTKNAPHKPHPHELVGKDCKHGYYEADLQERRIHSFQNLGIQCV
KKKDVNEAITCRLQTNNNPFNIPEAKVWEEEFDLNSVRLCFQASITLPTGETFPLEPVVS
QPIYDNRAPNTAELKICRVNRNCGSCKGGDEIFLLCDKVQKEDIEVRFFKDSWEGKGTFS
QADVHRQVAIVFRTPPYHDTNLKEPVKVQMQLRRPSDREVSEPMEFQYVPVEQDEYRLCQ
KRKCTGDMFQSLKLGPMLSTVCMPQERRHISTARRTVAVKPPVMNTQAAPTLPPGASAAK
SQAPYCFQPKVEASSASISAATTNQTWKIMESLNLGPRPKATPVSFSMTKPPSSTSSSSS
SCSSTTNQEYSTVNLADLPDFFPNISSTLTQEPSSPGYPIFRAGTRLADEDIPEFPSFSE
AQGTLESLNMDEFEDLLKPCLVNEDENNAQPSCQQVPSAAQNNTLTQNSSEPASNPGSTW
MNYPNSIVNLLQNENMIVMGSSSNNYQAPVLDEFDELMSADEDRLISIFNSESHAGFVSG
HHT
NT seq 1812 nt   +upstreamnt  +downstreamnt
atggatggtgtgtatggatggggcttgaccccgctgaaccaagtacaaacaaccccttac
atcgagattattgagcagccaaagcagaggggcatgaggtttaggtacaagtgtgaggga
cgttcagcgggcagcattcccggagagaagagcaacgacaccactaagactcatccagca
atcaaggtgcacaactacagtggccctctgcgtgttcgcatttcactggtaacaaagaat
gctccacacaagcctcaccctcacgaactggttgggaaggactgcaaacacggttactat
gaggccgacttgcaggagagacgaatacacagtttccagaacctgggcatacagtgtgtg
aagaagaaggatgtgaacgaggccatcacttgtaggctgcagaccaataacaaccccttc
aatatacctgaagcaaaggtgtgggaggaggagtttgacctgaactcagttcgactctgc
ttccaggcttccatcactctgcccacgggggagacgtttcctttggagcctgtcgtatcg
cagcccatttacgacaacagagctccaaacacagcagaactgaagatctgtcgagtcaac
cgtaactgtgggagctgcaagggaggcgatgaaatctttctactgtgtgacaaagtgcaa
aaagaagatatcgaggtgcgtttcttcaaggactcctgggagggaaaaggtacgttctct
caggctgacgtccacaggcaggtggccattgtgttccgcacgccgccataccatgacact
aatctcaaggagcccgttaaggtccaaatgcagctgcgccgcccgtccgatcgtgaggtc
agcgagccaatggaattccagtatgtgcctgttgaacaagatgagtacagactgtgtcaa
aagaggaaatgcacaggagacatgttccagagcctgaagctggggcccatgctgtccact
gtgtgcatgccacaagaaagacgacacatcagcactgcaaggaggacagtcgcagtcaag
cctccagtgatgaacacacaagctgcacctacactgccccctggtgccagtgcagccaaa
tctcaggctccgtactgcttccaacccaaggtggaagcatcctctgcctccatctcagct
gcaaccacaaatcaaacatggaaaatcatggagagcctcaaccttgggcctcggcccaaa
gctactcctgtgagtttctccatgaccaaaccaccatcctccacctcttcctcttcttcc
tcatgtagctccaccaccaaccaggaatactccactgtcaacctggcagaccttcctgat
ttcttccccaacatttcctccacccttacccaagagccctctagtcccggatacccaatt
ttcagggcgggcacacgcttggcggatgaagatatcccagagttcccaagcttttctgag
gcgcaaggcaccttggaaagcctgaacatggatgagtttgaggaccttctgaaaccctgc
cttgtgaatgaggacgaaaacaatgcccagccttcgtgccaacaagttccatcggctgcc
cagaacaacacattaactcagaactcttctgagcctgcctccaacccgggaagcacctgg
atgaattacccaaacagcattgtcaacctgcttcagaatgaaaacatgatcgttatgggc
tcctccagcaacaactaccaagcccctgtgctggacgagtttgacgagctcatgtctgct
gacgaggatcgtctcatttccatttttaacagtgaaagccatgctggctttgtgtcagga
caccatacctag

DBGET integrated database retrieval system