KEGG   Cynoglossus semilaevis (tongue sole): 103385652
Entry
103385652         CDS       T04866                                 

Gene name
rassf1
Definition
(RefSeq) ras association domain-containing protein 1 isoform X1
  KO
K09850  Ras association domain-containing protein 1
Organism
csem  Cynoglossus semilaevis (tongue sole)
SSDB
Motif
Pfam: RA Nore1-SARAH C1_1 Ras_bdg_2
Other DBs
NCBI-GeneID: 103385652
NCBI-ProteinID: XP_008317815
UniProt: A0A3P8X4L6
LinkDB
Position
11
AA seq 365 aa
MSWGEFIELRELRTNKDETKPMDAHVPCSPPRLERTNALRISPGKVPDMLSRVGIIRVLS
SAHDPQPTEEKGEGHNFQPCSHAQPTWCDLCGDFIWGLYKQSLRCVNCKFTCHYRCRALI
QLDCSWDGGSVSDQTCVLEHTVETDTDVDEKTESGKQELTTAAVQQKVKDYNTQINSNLF
MNMNKDGSYTGFVKVQFKLARPVSVHSAKKGSHDGGGKKGAGVKRRTSFYLPKDASKHLH
ISSRTSAREVIEALLKKFTVVDNPGKFALFERSERHDQVYVRKLSDDERPLRLRLNAGPS
EKVLTFLLKENETGEVNWHAFSMPELKNFLRILQREEEEHVKQIVQRYALARTKMQEALA
GSTPG
NT seq 1098 nt   +upstreamnt  +downstreamnt
atgtcgtggggtgagttcatcgagctccgtgagctgcgcacaaacaaagatgagacgaag
ccgatggacgctcatgtcccctgctcgccgcctcgtctggaaagaaccaacgctcttaga
atcagcccggggaaagtcccagacatgctgagccgcgtgggcatcatcagagttctgagc
agtgcccacgacccgcagcccacagaggagaaaggagagggacacaacttccagccctgc
agccacgctcagcccacgtggtgcgacctgtgtggagacttcatctggggcctgtacaag
cagagcctgcggtgtgtcaactgtaaattcacgtgtcactatcgctgtcgtgccctgatc
cagttggactgcagctgggacggaggctcagtgtctgaccaaacatgtgtcctggaacac
accgtagaaacagacaccgatgtggatgagaaaactgaaagtggaaagcaggagttgacg
actgcagccgttcagcagaaggtgaaggactacaacacccagatcaacagcaacctcttc
atgaacatgaacaaggacggctcctacaccggcttcgtgaaggtgcagttcaagctggct
cgccccgtgtccgttcactccgccaagaaaggaagtcacgacggtggggggaagaagggg
gccggcgtcaagcgtcgaacctcgttctacctgccaaaagatgcatccaagcacctgcac
atcagctctcgcacctctgcccgtgaggtcatcgaggctttgctcaaaaagtttacggtg
gtggacaatcctgggaagttcgctctgtttgagcgaagcgagcgtcacgaccaggtttat
gtccgtaagctgtctgacgacgagaggccactgcgtctccgtctgaacgctggacccagt
gagaaagtcctgacttttctgctcaaagaaaatgaaaccggagaagtcaactggcacgcc
ttctccatgccagagttgaagaacttcctgcgtattctgcagcgtgaagaagaagaacac
gtcaagcagatagtgcagcggtacgctctggcccgcaccaagatgcaggaggctctggct
ggatccacgcctggctga

DBGET integrated database retrieval system