KEGG   Cynoglossus semilaevis (tongue sole): 103385772
Entry
103385772         CDS       T04866                                 

Definition
(RefSeq) uncharacterized protein LOC103385772 isoform X1
  KO
K08774  transforming growth factor, alpha
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem04010  MAPK signaling pathway
csem04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:csem00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103385772
   04012 ErbB signaling pathway
    103385772
SSDB
Motif
Pfam: EGF Laminin_EGF Spore_III_AB DUF3377
Other DBs
NCBI-GeneID: 103385772
NCBI-ProteinID: XP_008317975
UniProt: A0A3P8UP11
LinkDB
Position
11
AA seq 247 aa
MTRIFWDTVLLISGSLFTFGAGPSNSTIQAPVSFDTNSSVASNTSLSSSANASSSANTHE
AHQVRSLIFTFEAGKRNESLFDAGRPVHPNDAVPQNISAPTGSNSRTTTTTTTSAAATTT
SSLQVKKFVIAAVRSHFDECPDSHRHFCFHGTCRFLILEETPACVCHPGFMGMRCEHADL
LAVVATNHRPHNVATALVLCVIGCVLIILLCTLLHCWWQQDCRRRRYTQRYVQEKHATSC
YPPESVV
NT seq 744 nt   +upstreamnt  +downstreamnt
atgacacggattttctgggacacagttcttctcatcagcggttccctctttacttttgga
gcagggccaagcaactcaacgattcaagctcccgtatcctttgatacaaactcgtctgtc
gcttcaaacacctcgctgagcagcagcgctaacgcgagctcctccgctaacacacatgaa
gctcatcaagtcagaagtctcatcttcacatttgaagcagggaagagaaacgagtcactc
ttcgatgctgggcgtccggtccatccaaatgatgctgttcctcagaacatctctgcacca
acaggcagcaacagcaggactacaactacaacgacaacatctgcagcagctacaaccacc
agcagcctccaggttaaaaagtttgtgatcgcggccgttcggtcacatttcgacgagtgt
ccagactcccatcgccacttctgcttccacggcacatgtcgtttcctgatactggaggag
acgcctgcgtgtgtgtgccatccaggcttcatggggatgaggtgtgaacacgcagacctg
ctggctgtggtggcgaccaatcacagaccacacaacgttgccacggcgctggtgttgtgt
gttattgggtgtgttctcatcatactgttgtgtacactgttacattgctggtggcagcag
gattgtcgacggcgacgttacacacagcgttacgtccaggagaaacacgccacttcctgt
tatcccccagagagcgtggtttga

DBGET integrated database retrieval system