KEGG   Cynoglossus semilaevis (tongue sole): 103385801
Entry
103385801         CDS       T04866                                 

Definition
(RefSeq) ras association domain-containing protein 1-like
  KO
K09850  Ras association domain-containing protein 1
Organism
csem  Cynoglossus semilaevis (tongue sole)
SSDB
Motif
Pfam: Nore1-SARAH RA C1_1
Other DBs
NCBI-GeneID: 103385801
NCBI-ProteinID: XP_008318012
UniProt: A0A3P8UJJ4
LinkDB
Position
11
AA seq 363 aa
MSKSELIELKDLTLNDPIELAAPPAPAAPASVSTGQPSVRAVYLSGENVSVQGAVCETGG
AGVGHHFQPCSQAHPAWCDLCGEFIWGLYKRCLRCSNCSYTCHHRCRPLIQLDCSTDGGL
LEHPVSDSCVDALETDTNVDEQRDKRELSVGEIQQKVKEYNSLINTNLHMLVKKDGVFTG
FIKVHFQLVRPVSLPPAQSCCSTPEEAHQTRRRSRRTSFYLPKDTAKHLHISCRTRVLEV
IEALLKKFMVVDSPAKFALFERTERQSQVYMRKLSNDERPLCLRLCAGPSEKALSLILKE
NNSGEINWDAFSLPELCNFLRFLQREEEEHVRQIVKRYALAREKLTQALVRMTTQKDKND
PRR
NT seq 1092 nt   +upstreamnt  +downstreamnt
atgtcaaagtccgagctgatcgagctgaaagacctcactctcaatgatcccattgaactg
gccgcccccccggcccccgcggcccccgcctctgtgagcacgggtcagccctccgtccgt
gccgtctacttgtctggagaaaacgtcagcgtgcagggagccgtctgtgagacagggggc
gctggcgtcggtcaccacttccagccctgcagtcaggctcatcctgcctggtgtgacctt
tgtggggagttcatctggggtctctacaaacgctgtttacgctgcagcaactgcagttac
acctgccaccaccgctgtcgaccgctcatccagctggactgcagcacagacggaggttta
ctggaacatccggtttctgattcctgtgtcgatgctctggagacggacaccaacgtggat
gaacagagagataaacgggagctgagcgttggagagatccaacagaaggtgaaggagtac
aattctctgatcaacaccaatctccacatgctggtcaaaaaagacggcgtcttcaccggt
ttcatcaaggtgcactttcagttagtccgaccagtttccctccctcctgctcagagctgc
tgctccacaccagaggaggcgcaccagaccaggaggaggtcacggcggacgtcgttctac
ctcccgaaagatactgcgaaacacctgcacatcagctgccgaacgcgggtgctggaggtc
atcgaggctttgctcaaaaagttcatggtcgtggacagtccggcaaaatttgcactgttt
gaacgcacggagagacaaagtcaagtgtacatgcgtaaactgtccaacgacgaacgcccg
ctctgtttacgtctgtgcgctggtcccagtgaaaaagctctgagtctgattttgaaggaa
aacaactcaggggaaattaattgggatgcgttcagccttccggagctgtgcaactttctg
cgattcctgcagcgtgaagaagaagagcacgtgcggcagatagtgaagcgttacgctctc
gctagagaaaagctaacgcaggctctggtgaggatgacgactcagaaggataaaaacgat
cctcgtcgttaa

DBGET integrated database retrieval system