KEGG   Cynoglossus semilaevis (tongue sole): 103385849Help
Entry
103385849         CDS       T04866                                 

Gene name
sdhb
Definition
(RefSeq) succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem00020  Citrate cycle (TCA cycle)
csem00190  Oxidative phosphorylation
csem01100  Metabolic pathways
csem01200  Carbon metabolism
Module
csem_M00009  Citrate cycle (TCA cycle, Krebs cycle)
csem_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
csem_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:csem00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    103385849 (sdhb)
  Energy metabolism
   00190 Oxidative phosphorylation
    103385849 (sdhb)
Enzymes [BR:csem01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     103385849 (sdhb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer2 Fer4_9 Fer4_7 Fer4_18
Motif
Other DBs
NCBI-GeneID: 103385849
NCBI-ProteinID: XP_008318073
LinkDB All DBs
Position
11
AA seq 297 aa AA seqDB search
MNAGIAGSIGQRSSKMSAVGLTSLSRCTVSALRCHTALGAVRCAQTAAAPAAQPRIKKFQ
IYRWDPDTPGDKPRMQTYEIDLNTCGPMVLDALIKIKNEMDSTLTFRRSCREGICGSCAM
NINGGNTLACLNRIDTNLNKPSKIYPLPHMYVVKDLVPDMSNFYAQYKSIEPYLKKKDET
KEGKEQYLQTVEDRQKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSR
DEFTEERLAKLQDPFSLYRCHTIMNCTKACPKGLNPGKAIAEIKKMMATYKEQRAIA
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgaatgctgggatagcgggtagcataggtcagagaagctccaaaatgtcggctgttggg
ttgacgtccttgagccgctgtacagtttcggcactccgctgtcatacagcactgggggcg
gtgcgatgtgctcaaacagcagcagctccagcagctcagcccagaataaaaaagtttcag
atttaccgatgggacccagacactccaggagacaaacctcgcatgcagacctatgagatt
gacctcaacacttgtggcccaatggttcttgatgcactcatcaagataaaaaatgagatg
gactccaccctgaccttccgccgctcctgcagagagggtatttgtggatcgtgtgccatg
aacattaatggaggaaacacacttgcttgtctaaacaggatcgataccaacctgaacaag
ccatcaaagatctaccctctgccacacatgtatgtggtcaaagatctagtgcctgacatg
agtaacttctacgcacagtacaagtctattgaaccctacctgaagaagaaggatgagacc
aaggaggggaaagaacagtacctgcagactgtggaagaccgacaaaaactggacggactg
tacgagtgcatcctgtgtgcctgctgcagcaccagctgccccagttactggtggaacgga
gacaaataccttggacctgctgtgctcatgcaggcctatcgctggatgattgattcacgt
gacgagttcacagaggagcgtctggccaagctgcaggatccgttctccctctaccgctgc
cacactatcatgaactgcaccaaggcctgtccaaaggggctgaaccctgggaaagcgata
gctgagatcaagaagatgatggccacgtacaaggagcagcgggcgattgcctga

DBGET integrated database retrieval system