KEGG   Cynoglossus semilaevis (tongue sole): 103385882
Entry
103385882         CDS       T04866                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 1-like isoform X1
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem04012  ErbB signaling pathway
csem04068  FoxO signaling pathway
csem04110  Cell cycle
csem04115  p53 signaling pathway
csem04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:csem00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    103385882
   04068 FoxO signaling pathway
    103385882
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103385882
   04115 p53 signaling pathway
    103385882
   04218 Cellular senescence
    103385882
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 103385882
NCBI-ProteinID: XP_008318123
LinkDB
Position
11
AA seq 194 aa
MLHRDSRSEMFGSSLTTLVLHSAMCRTMAAPQKVLSPFGNGPTRRNLFGPVDREQLQVEY
QTALRKDLEDASRRWGFDFVSDKPLESGDYXXXXXIPDATVPLLYRSCTSGQGRTRAQTL
AEATMTTKCGRLELPQSEKENIPLTLERCILDLERLQKTPEKKEEAGAKRKQTNITDFYL
AKRRVVWMPRKSGE
NT seq 585 nt   +upstreamnt  +downstreamnt
atgctgcaccgtgacagcagatcagagatgtttggtagttcactgacgacactggtacta
cactcagccatgtgcagaacaatggcagctcctcagaaagttttgagcccttttgggaac
ggccccactcgacgaaacctcttcggcccagtcgaccgagagcagctgcaggtagaatac
cagacggccctgcggaaagacctggaagacgcttctcgacgctggggcttcgacttcgtc
tccgacaagcccctggagagcggcgactaccannnnnnnnnnngcattcctgacgccacg
gttccactgctgtaccgatcctgcacgtctggtcagggcaggaccagggcccaaacgctg
gcagaggcaacgatgaccaccaagtgtggacggttggagttgccacagagtgagaaggaa
aacatcccactgacgctggagaggtgcattctggacctggagagactgcagaaaacccca
gagaaaaaagaggaggccggggcgaaaaggaaacagacaaatattacagatttctatctg
gccaagagaagagtagtttggatgccgcgtaaatcaggcgagtga

DBGET integrated database retrieval system