KEGG   Cynoglossus semilaevis (tongue sole): 103385936Help
Entry
103385936         CDS       T04866                                 

Gene name
prkcd
Definition
(RefSeq) protein kinase C delta type
  KO
K06068  novel protein kinase C delta type [EC:2.7.11.13]
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem04140  Autophagy - animal
csem04270  Vascular smooth muscle contraction
csem04621  NOD-like receptor signaling pathway
csem04625  C-type lectin receptor signaling pathway
csem04912  GnRH signaling pathway
csem04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:csem00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103385936 (prkcd)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    103385936 (prkcd)
   04625 C-type lectin receptor signaling pathway
    103385936 (prkcd)
  09152 Endocrine system
   04912 GnRH signaling pathway
    103385936 (prkcd)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    103385936 (prkcd)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    103385936 (prkcd)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:csem01001]
    103385936 (prkcd)
Enzymes [BR:csem01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     103385936 (prkcd)
Protein kinases [BR:csem01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   103385936 (prkcd)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr C1_1 Pkinase_C C1_2 zf-RING-like Kinase-like Zf_RING Pkinase_fungal Haspin_kinase APH PHD zf-RING_9
Motif
Other DBs
NCBI-GeneID: 103385936
NCBI-ProteinID: XP_008318190
UniProt: A0A3P8UWZ3
LinkDB All DBs
Position
11
AA seq 684 aa AA seqDB search
MAPFLRITFNSYDLGILPPSDDAPFCAIKMKEALTTERGKTLVQRKPTMYPAWKASFDAH
IYEGRVLEVLLMKTAEEPLAEVSVGVSVLAERCKKANGRAEFWVDLHPSGKVMMAVQYFL
EGVDTERKQEPKDEEGPTLNRRRGAIKQAKIHFIKNHEFIATFFRQPTFCSVCRDFVWGL
NKQGYKCRQCNAAIHKKCIDKIIGRCTGTAANSRDTMFQKERFKIDMPHRFKIHNYMSPT
FCDHCGSLLWGIVKQGLKCEDCAMNVHHKCQDKVANLCGINQKLLAEALTQVSQKSSTRR
SDPAMPNLSDIGIYDEVNKLAGLEINEGPAYGRLWEGSSPRPQSRLTHLTRINVDNFIFH
KVLGKGSFGKVLLAELKGRGEYFAVKALKKDVVLMDDDVECTMVEKRVLALAWENPFLTH
LYSTFQSKEHLFFVMEYLNGGDLMFHIQEKGRFDLCRTTFYSSEIICGLQFLHSKGIIYR
DLKLDNVMLDHEGHIKIADFGMCKENVLGENRATTFCGTPDYIAPEILLGQKYSFSVDWW
SFGVLLYEMLVGQSPFHGDDEDELFESIRMDTPHYPRWINKEAKDLLERMFERDPTRRLG
VVGNIRLHPFFAVINWQALERREVEPPFKPKVKAPNDCSNFDHEFLSEKPRLSYSDKNFI
DSMDQSAFAGFSFINPKMEHLLEK
NT seq 2055 nt NT seq  +upstreamnt  +downstreamnt
atggctccttttttgaggatcaccttcaactcgtacgacttgggcatcctgcctccgtcg
gacgatgctcctttctgtgcgatcaagatgaaggaggccttgacgactgagcgaggtaag
acactggtccagcggaaacccaccatgtacccagcctggaaggccagttttgacgcacac
atctatgagggtcgggtacttgaggttctgctgatgaagacggcagaggagcctttggcc
gaggtctccgtcggcgtctctgttctggccgaacgctgcaagaaagccaacggccgtgcg
gaattctgggtggatctgcatccttctgggaaggtgatgatggctgtgcagtattttctg
gagggggtggacacagagagaaagcaggagccgaaagacgaggagggcccgactctgaac
cgcagacgaggagccatcaaacaggccaagatccacttcatcaagaaccatgagttcatt
gccacgttcttcagacagccgacgttctgctctgtgtgcagggattttgtctggggcctc
aacaagcagggctataaatgcagacaatgcaatgcagccatccacaagaaatgcatagac
aaaattattggcagatgcaccggcacggctgccaacagcagggatactatgttccagaag
gaacgttttaagattgacatgccgcaccgttttaagatccacaactacatgagtcccacc
ttctgtgaccactgtggaagtctgctgtggggcatcgtcaaacagggcctgaagtgtgaa
gactgtgccatgaatgttcatcacaagtgtcaggataaagttgccaacctttgtggaatc
aaccagaagcttctggctgaagcgctgacacaagtcagtcagaaatcgtccacccgccgc
tctgatcctgctatgccaaatctgtctgacattggaatctatgatgaagtgaacaaactt
gctggtctggaaatcaatgagggacccgcctatggtcggctgtgggaggggtccagtccg
aggcctcagtctcgtcttacccatctgacgcgcatcaacgtggacaactttatcttccac
aaggtcctaggaaaaggcagctttggcaaggtactcctcgcagagctgaagggtcgcggt
gagtactttgccgtgaaggccctgaagaaagacgtggtgttgatggatgacgacgtggag
tgcactatggtggagaagagagtcctggctctggcctgggagaaccctttcctcacgcac
ctttactccacctttcagagcaaggagcatctgttctttgtgatggaatacctgaacgga
ggagacttgatgtttcatattcaggagaagggacgctttgatctctgcagaaccaccttc
tactcgtccgagatcatttgtggtctccagtttctacactccaaaggcatcatctacaga
gaccttaagttggacaacgtgatgctggatcacgagggacacataaagatcgcagacttc
ggcatgtgcaaggagaacgtgttgggagagaatcgtgccacgaccttctgtggcactccg
gactacatcgctccagagatcctgctgggacagaaatactccttctcagtcgactggtgg
tcgttcggcgtgctgctgtacgagatgctggtcggacagtcgccgttccacggagatgat
gaggacgagctgtttgagtccatccgcatggacactcctcactacccccgctggatcaac
aaagaagccaaggacttgttggagaggatgtttgagagagatcccactcgcaggctaggg
gttgtgggtaacattcgtttgcaccccttcttcgcggtcataaactggcaggctctggag
agaagagaggtggagcctcccttcaaacctaaagtgaaagcgcccaatgattgcagcaac
tttgaccacgagttcctcagcgagaaacctcgtctctcctacagcgacaagaacttcatc
gactccatggatcagtcggcgtttgctggcttctcattcatcaacccaaagatggagcac
ctattagaaaagtaa

DBGET integrated database retrieval system