KEGG   Cynoglossus semilaevis (tongue sole): 103385968Help
Entry
103385968         CDS       T04866                                 

Definition
(RefSeq) ATP-dependent 6-phosphofructokinase, muscle type-like
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem00010  Glycolysis / Gluconeogenesis
csem00030  Pentose phosphate pathway
csem00051  Fructose and mannose metabolism
csem00052  Galactose metabolism
csem01100  Metabolic pathways
csem01200  Carbon metabolism
csem01230  Biosynthesis of amino acids
csem03018  RNA degradation
Module
csem_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:csem00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    103385968
   00030 Pentose phosphate pathway
    103385968
   00051 Fructose and mannose metabolism
    103385968
   00052 Galactose metabolism
    103385968
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    103385968
Enzymes [BR:csem01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     103385968
Protein phosphatases and associated proteins [BR:csem01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     103385968
Messenger RNA biogenesis [BR:csem03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     103385968
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 103385968
NCBI-ProteinID: XP_008318237
LinkDB All DBs
Position
11
AA seq 778 aa AA seqDB search
MAQTATIDPTKMGEGRAIAVLTSGGDAQGMNAAVRATVRVGLYTGARVFFVHEGYQGLVD
GGDHIRPATWESVSMMLQLGGTVIGSARCQDFRSKEGRTKAAYNLVKLGITNLCVIGGDG
SLTGANAFRTEWSELLSDLVKAGKITIHEAKSSSHLNIVGMVGSIDNDFCGTDMTIGTDS
ALHRIIEIVDAITTTAQSHQRTFILEVMGRHCGYLALVTALACGADWVFIPEMPPEDKWE
EHLCRRLTEQRGRGSRLNIIIVAEGAMDRCGKPITCEHVKQLVSKKLGFDTRTTILGHVQ
RGGTPSAFDRILASRMGVEAVMALLEATPDTPACVVSLSGNMAVRLPLMECVQVTKDVTV
AMGEGRFDDAVRLRGKSFENNWNTYKMLAHVHIPEKKSNINIAIVNVGAPCSGMNAAVRS
AVRIGILQGHQMLAVHDGFDGLAQGLIEPIGWAGVAGWTGKGGSMLGTKRSLPNEFIEEI
SLNIAKFNIHALVIVGGFEAFVGGLEMVQAREKYEELCIPLVVVPATVSNNVPGSDFSIG
ADTALNTITMTCDRIKQSAAGTKRRVFIVETMGGYCGYLATMAGLAAGADAAYIYEDPFN
IHDLELNVEHLVEKMKTTVKRGLILRNEKSNANYTTDFIFNLYSEEGKGIFDCRKNVLGH
MQQGGTPSPFDRNFGTKMGMKSVLWLTDKIKECYRHGRIFANSPDSACVLGMKKRSLVFQ
PLLELKGFTDFEHRIPKVQWWLKLRPILKILAKYKINLDTSEKTAMEHIIKKRGLVPQ
NT seq 2337 nt NT seq  +upstreamnt  +downstreamnt
atggcacaaacggccaccatcgaccccaccaagatgggagagggtcgggcgatcgccgtg
ctgacctcgggaggcgacgcccagggaatgaatgctgctgttagagccaccgttcgagtt
ggactctacaccggagccagagtgttctttgtccatgagggttatcagggtctggtggac
ggtggagaccacattcgcccggctacttgggagagcgtgtcaatgatgctgcagctgggt
gggaccgtgatcggcagcgcccgctgccaggatttccgcagcaaggagggacgcacgaag
gctgcctacaacctggtcaagttaggcatcaccaacctgtgtgtgatcggaggtgatggc
agtctcactggtgccaatgcgttcaggacagagtggagtgaactgctgtcagacctggtc
aaagcaggtaagatcaccattcatgaggccaagagttcctcccacctgaacatcgtcggc
atggtgggctccattgacaacgacttctgtggaaccgatatgaccatcggcacagattct
gccctgcatcgcattatagagatcgtggatgccatcaccaccacagcacagagtcaccaa
aggacgttcattctggaggtcatgggtcgccactgcggttacctggctctagtgacagcg
ctggcctgcggtgctgactgggtgttcatcccagagatgccaccggaggacaaatgggag
gagcatctgtgcagacgactgacagaacaaagggggcgtggctcccgtttgaacatcatc
atcgtcgcagaaggagcgatggaccgctgtggtaagcctatcacgtgtgaacacgtgaaa
cagctggtctcaaagaagctcggctttgacactcgcaccaccatcttgggccacgtgcag
aggggcggaacaccctccgcctttgacagaatcctggcaagcaggatgggtgtcgaggct
gttatggctctgctggaggccacaccagacactcctgcctgtgtggtcagcctgtctggg
aacatggctgtcaggctgcctctgatggagtgtgtgcaagtgaccaaggacgtcaccgta
gcgatgggtgaagggaggtttgatgatgctgtgaggctcaggggaaagagcttcgagaac
aactggaacacttacaaaatgttggctcacgtccacattccagaaaaaaagagcaatatc
aacatcgctatcgtcaacgtgggggctccctgctctggaatgaacgccgcagtccgctca
gctgtcagaatcggaattctgcagggccatcagatgttggcggtgcatgacggctttgat
ggtttggctcaaggattgatcgagcctattggctgggcaggagtggcaggatggacagga
aaaggtggctccatgttgggaacaaagagatctctgccaaatgagttcatagaagagatc
agtctgaacatcgctaagttcaacattcatgctttagtcattgttggaggctttgaggca
tttgttggaggtctggagatggtgcaggcgagagagaagtacgaggaactgtgcattcct
ctggttgttgttcctgccactgtctccaacaatgttcccggatccgacttcagtattggc
gctgacactgccctcaacaccatcaccatgacctgtgaccgaatcaaacagtctgccgcc
ggcacgaagaggagggtgtttattgtcgaaacgatggggggatactgtggctacttggca
accatggccggcctggcagcaggagctgatgctgcgtacatctacgaggatcctttcaac
atacatgacctggagttgaacgtggaacatctggtggagaagatgaagaccacagtgaag
agaggactcattctgagaaatgagaagagcaatgccaactacacaacggacttcatcttt
aacctgtactcagaggaaggaaagggtatatttgactgcaggaagaatgtccttggacat
atgcaacagggcggaacgccaagtccttttgacaggaactttggcacaaaaatggggatg
aagtcggtcctttggctcactgacaagatcaaggaatgctacagacatggccgaatcttt
gccaactctccagattcagcctgtgttctgggaatgaaaaagagatctttggtctttcag
cctctgttagaactcaaaggattcactgactttgagcaccgtattccaaaggttcagtgg
tggttaaagctgaggcccatcctgaaaatcctggccaagtacaagatcaacctggacacc
tctgaaaagactgccatggaacatatcatcaagaaacgaggcttagttcctcagtag

DBGET integrated database retrieval system