KEGG   Cynoglossus semilaevis (tongue sole): 103386039
Entry
103386039         CDS       T04866                                 

Gene name
cdk2
Definition
(RefSeq) cyclin-dependent kinase 2
  KO
K02206  cyclin-dependent kinase 2 [EC:2.7.11.22]
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem04068  FoxO signaling pathway
csem04110  Cell cycle
csem04114  Oocyte meiosis
csem04115  p53 signaling pathway
csem04218  Cellular senescence
csem04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:csem00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    103386039 (cdk2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103386039 (cdk2)
   04114 Oocyte meiosis
    103386039 (cdk2)
   04115 p53 signaling pathway
    103386039 (cdk2)
   04218 Cellular senescence
    103386039 (cdk2)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    103386039 (cdk2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:csem01001]
    103386039 (cdk2)
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:csem03032]
    103386039 (cdk2)
   03036 Chromosome and associated proteins [BR:csem03036]
    103386039 (cdk2)
Enzymes [BR:csem01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     103386039 (cdk2)
Protein kinases [BR:csem01001]
 Serine/threonine kinases: CMGC group
  CDK family
   103386039 (cdk2)
DNA replication proteins [BR:csem03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    103386039 (cdk2)
Chromosome and associated proteins [BR:csem03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    103386039 (cdk2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Haspin_kinase APH Kdo Kinase-like
Other DBs
NCBI-GeneID: 103386039
NCBI-ProteinID: XP_008318341
UniProt: A0A3P8UTF2
LinkDB
Position
11
AA seq 298 aa
MDSFQKVEKIGEGTYGVVYKAKNKVTGETVALKKIRLDTETEGVPSTAIREISLLKELSH
PNIVKLRDVIHTENKLYLVFEFLQQDLKKFMDSSSVTGIPLPLVKSYLFQLLQGLAFCHS
HRVLHRDLKPQNLLINTQGEIKLADFGLARAFGVPVRTYTHEVVTLWYRAPEILLGCKYY
STAVDIWSLGCIFAEMITRRALFPGDSEIDQLFRIFRTLGTPDETIWPGVTSLPDYKPSF
PKWAQQDLSKVVPLLDEDGRELLGEMLSYDPNKRLSAKNALVHRFFRDVTMPIPHLRL
NT seq 897 nt   +upstreamnt  +downstreamnt
atggattcgtttcaaaaggtagagaagataggggaagggacgtacggagtcgtttacaaa
gccaaaaacaaagtgaccggagaaactgtggctctaaagaaaatccgactggatacggaa
acagaaggtgtgcccagcactgccatacgagaaatttctctcctcaaagaactcagtcat
ccaaacatcgtcaaattgagggacgtcatccatacggagaacaaactctaccttgtattt
gaatttcttcaacaggatctgaagaagttcatggactcttcctcagtcactggtatccct
ctgcctctggtgaagagttatctgttccagttgctgcagggcctggccttctgtcactcc
cacagggtcctgcatcgggacctcaagccacagaacctcctcatcaacactcagggagag
atcaaactcgccgacttcggcctagcgagagccttcggagtacctgttcgcacgtacaca
cacgaggtggtaacactttggtacagggcaccagaaattctccttggctgcaaatactac
tccacggctgttgacatctggagtcttggctgcatttttgcagagatgatcaccaggagg
gctttattccccggcgactcagagatcgatcaactcttcagaatcttccgcaccttagga
acgcccgatgagaccatctggcccggagtcacctcactgccggactataaaccgtccttc
ccaaaatgggcgcagcaggatctatccaaagtggttcctcttctggatgaggatgggaga
gagttgctgggagagatgctcagctacgatccgaacaaaaggttgtctgcaaaaaatgct
ctcgtgcatcgattcttccgtgacgtcaccatgcccataccacacctgagactgtga

DBGET integrated database retrieval system