KEGG   Cynoglossus semilaevis (tongue sole): 103386271Help
Entry
103386271         CDS       T04866                                 

Gene name
hdac8
Definition
(RefSeq) histone deacetylase 8
  KO
K11405  histone deacetylase 8 [EC:3.5.1.98]
Organism
csem  Cynoglossus semilaevis (tongue sole)
Brite
Enzymes [BR:csem01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     103386271 (hdac8)
Chromosome and associated proteins [BR:csem03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     103386271 (hdac8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 103386271
NCBI-ProteinID: XP_008318682
LinkDB All DBs
Position
1
AA seq 378 aa AA seqDB search
MSRGGEADEDGGVKRRVAYVFSSEFIQKCDSLSKVPNRASMVHSLIEAYGLLEHMMVIQP
QLASLEEMAKFHTDSYLEHLHKISQDGDNDDPQSTDFGLGYDCPVVEGIYEYAASVGGAT
LTAAQCLLEDKCDVALNWAGGWHHAKKDQASGFCYVNDAVLGILKLREKFDRVLYVDVDL
HHGDGVEDAFSFTSKVMTVSLHKFSPGFFPGTGDVCDTGLGKGRWYAVNVPLEDGIKDDR
YYQIFSSVMQDVRAQFNPLAVVMQLGADTMAGDPMCSFNMTPVGVARCLSSVLQWKLPTL
LLGGGGYHLANTARCWTFLTAAVLGKTLSSEIPDHEFFTEYGPDYSLEISPSCRPDRNDS
KHLQQLLSTIRGNLKNVV
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgcggaggagaagctgacgaggacggaggtgttaaaagaagagttgcctatgtt
tttagctcggagttcattcaaaaatgcgacagtttgtccaaagtaccgaacagggccagt
atggtccactcgttgatagaagcctatggtctgctggaacacatgatggttatacagcct
cagctggcctccctggaggaaatggccaagtttcacacagactcgtacctggagcatctt
cacaaaatcagtcaggacggagataacgatgacccacagtcgactgatttcggcctgggt
tatgactgtccagtagtggagggaatatatgagtacgcagcttcagtgggtggagccaca
ctgactgcagctcagtgtctgctggaggacaaatgtgatgtggccctgaactgggctgga
ggctggcaccacgctaagaaagaccaggcctcggggttttgttatgtaaacgatgctgta
ctgggaatcctcaaactgagagagaaatttgatcgcgttctctatgttgacgttgacctt
catcatggtgatggtgtggaagacgccttcagcttcacctccaaagtcatgactgtctct
ctgcataaattctcacctggattcttcccaggtacaggtgatgtgtgtgacactggtctg
ggtaaaggtcgatggtacgccgtcaatgtccctttagaggatgggatcaaagacgacaga
tactaccagatctttagcagtgtgatgcaagacgtgcgagcccagttcaacccattggct
gtggttatgcagctcggtgccgacactatggcgggcgaccccatgtgttccttcaacatg
accccagtgggtgtggccaggtgtctgagctccgttctgcagtggaagctgcccacgctg
ctgctgggaggaggaggctatcatctggctaacacagctcgctgctggacctttctgact
gctgctgtgctgggaaaaactctgtcctctgagataccagaccacgagtttttcacagaa
tacgggccagactattctctggagatcagtcccagctgtagacctgaccggaacgattcc
aaacacctgcagcagctcctgagcaccatcagagggaatttaaagaatgtggtttag

DBGET integrated database retrieval system