KEGG   Cynoglossus semilaevis (tongue sole): 103386871
Entry
103386871         CDS       T04866                                 

Gene name
ppp3r1
Definition
(RefSeq) calcineurin subunit B type 1
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem04010  MAPK signaling pathway
csem04020  Calcium signaling pathway
csem04114  Oocyte meiosis
csem04218  Cellular senescence
csem04310  Wnt signaling pathway
csem04370  VEGF signaling pathway
csem04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:csem00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103386871 (ppp3r1)
   04310 Wnt signaling pathway
    103386871 (ppp3r1)
   04370 VEGF signaling pathway
    103386871 (ppp3r1)
   04020 Calcium signaling pathway
    103386871 (ppp3r1)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    103386871 (ppp3r1)
   04218 Cellular senescence
    103386871 (ppp3r1)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    103386871 (ppp3r1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:csem01009]
    103386871 (ppp3r1)
Protein phosphatases and associated proteins [BR:csem01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     103386871 (ppp3r1)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 SPARC_Ca_bdg EF-hand_4 EF-hand_9
Other DBs
NCBI-GeneID: 103386871
NCBI-ProteinID: XP_008319522
UniProt: A0A3P8UJH9
LinkDB
Position
12
AA seq 170 aa
MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVID
IFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMV
GNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV
NT seq 513 nt   +upstreamnt  +downstreamnt
atgggaaatgaagccagttaccctctggagatgtgctcgcatttcgatgctgatgagatt
aagaggctagggaagaggtttaagaaactcgacctagataactctggctcgctcagcgtg
gaggagttcatgtcgctgccggagctgcaacagaacccgctggtgcaaagggttatcgac
atatttgatacagacgggaacggagaggtggactttaaagagttcatcgagggagtctca
cagttcagcgtcaagggcgacaaggaacagaagcttcggttcgccttcaggatctacgac
atggacaaggacggctacatctccaatggcgagctcttccaggtgctgaagatgatggta
ggcaacaacctgaaggacacgcagctccagcagatcgtggacaagaccataatcaacgca
gacaaggacggagacggcaggatatcctttgaagaattctgtgcagtggttggtggtctc
gatatacacaaaaagatggtggtggacgtgtga

KEGG   Cynoglossus semilaevis (tongue sole): 103390268
Entry
103390268         CDS       T04866                                 

Gene name
ppp3ca
Definition
(RefSeq) serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform isoform X2
  KO
K04348  serine/threonine-protein phosphatase 2B catalytic subunit [EC:3.1.3.16]
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem04010  MAPK signaling pathway
csem04020  Calcium signaling pathway
csem04114  Oocyte meiosis
csem04218  Cellular senescence
csem04310  Wnt signaling pathway
csem04370  VEGF signaling pathway
csem04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:csem00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103390268 (ppp3ca)
   04310 Wnt signaling pathway
    103390268 (ppp3ca)
   04370 VEGF signaling pathway
    103390268 (ppp3ca)
   04020 Calcium signaling pathway
    103390268 (ppp3ca)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    103390268 (ppp3ca)
   04218 Cellular senescence
    103390268 (ppp3ca)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    103390268 (ppp3ca)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:csem01009]
    103390268 (ppp3ca)
Enzymes [BR:csem01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     103390268 (ppp3ca)
Protein phosphatases and associated proteins [BR:csem01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Catalytic subunits
     103390268 (ppp3ca)
SSDB
Motif
Pfam: Metallophos
Other DBs
NCBI-GeneID: 103390268
NCBI-ProteinID: XP_008324285
LinkDB
Position
1
AA seq 532 aa
MSENKPNDEPKLSTTDRVVKSVPFPPSHRLTAKEVFDSDGKPKVDVLKAHLTKEGRVEEG
VALRLIGEGAAILRSERNLLDIDAPVTVCGDIHGQFFDLMKLFEVGGSPASTRYLFLGDY
VDRGYFSIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFKQECRIKYSERVYDACM
DAFDCLPLAALMNQQFLCVHGGLSPEITNLDDIRKLDRFKEPPAYGPMCDLLWSDPLEDF
GNEKSQEHFTHNTVRGCSYFYSYPAVCEFLHHNNLLSIIRAHEAQDAGYRMYRKSQTTGF
PSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGE
KVTEMLVNVLSICSNDELTTDEELDGQLIYPPKKGATASARKEVIRNKIRAIGKMARVFS
VLREESESVLTLKGLTPTGMLPCGVLAGGKEKLQNATIEAIEADEAIKGFSPQHKITSFE
EAKGLDRINERMPPRRDALPSDASLNSLNKALSSETNGTDAKGSTSSGSNIQ
NT seq 1599 nt   +upstreamnt  +downstreamnt
atgtccgaaaacaagccgaatgatgaaccgaagttatctacgacggacagggtggtgaaa
tctgtcccattccctccaagtcaccggttgacagctaaagaggtgtttgacagcgatggg
aagcccaaagtggatgtgctgaaagcccacttaaccaaggaagggcgtgttgaggaagga
gtagccctaaggctcataggagagggagctgcgatcttgcgttcagagaggaacctgctg
gatattgatgctcctgtgacagtgtgtggcgacatccatgggcagttctttgacctgatg
aaactctttgaggtcggaggatcaccggcttctactcgttaccttttcctgggggactac
gttgacaggggatatttcagtattgaatgtgtgctgtacttgtgggccttaaagatactg
taccccaaaacactgtttttgctgcgtgggaaccatgaatgtagacatttaacagagtat
ttcacatttaagcaagaatgtagaattaagtattcagagagggtgtatgacgcatgtatg
gacgccttcgactgccttcccttggctgcacttatgaaccagcagttcctttgtgtacat
ggaggactgtctccagaaatcacaaatcttgatgacatcaggaaactagacagattcaaa
gagccgccagcgtatgggcccatgtgcgacctgctgtggtccgaccccctggaggacttt
gggaatgaaaagagccaagagcattttacacacaacacagtgcgagggtgttcctacttc
tacagctaccctgcagtttgtgaatttctacatcacaataacttattatctatcatccgg
gcccatgaagcgcaagatgccggatatcgcatgtacagaaagagccagactactggcttc
ccgtcccttatcaccatcttctctgcacccaattacttagatgtctacaacaataaagcg
gctgttctgaagtatgagaacaacgtgatgaatattcgacagttcaactgttcacctcat
ccttactggctgcccaacttcatggatgttttcacttggtccctgcctttcgttggagag
aaggtgactgagatgctagtgaacgtgctgagcatctgttccaacgatgagctgacgact
gacgaggagctggatggacagctaatatatccccccaaaaaaggtgccaccgcctctgcc
cgtaaggaagtcatacgcaacaagattcgtgccattggaaagatggccagagtcttctct
gtgctcagagaggagagtgagagtgtgctgacactgaagggtctgaccccgactggcatg
cttccatgcggggttctggctggtggcaaagagaagctacaaaatgctactattgaagct
attgaggctgacgaagccatcaagggcttctcacctcagcataagatcaccagctttgag
gaggcaaagggcttggaccgcattaatgagaggatgccgccgcggcgagatgcgctgccc
tctgacgccagcctcaactccctcaacaaggccctgtcctcggagaccaacggcacggat
gccaagggaagcaccagcagtggcagcaacattcagtga

KEGG   Cynoglossus semilaevis (tongue sole): 103390394
Entry
103390394         CDS       T04866                                 

Definition
(RefSeq) serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform-like
  KO
K04348  serine/threonine-protein phosphatase 2B catalytic subunit [EC:3.1.3.16]
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem04010  MAPK signaling pathway
csem04020  Calcium signaling pathway
csem04114  Oocyte meiosis
csem04218  Cellular senescence
csem04310  Wnt signaling pathway
csem04370  VEGF signaling pathway
csem04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:csem00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103390394
   04310 Wnt signaling pathway
    103390394
   04370 VEGF signaling pathway
    103390394
   04020 Calcium signaling pathway
    103390394
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    103390394
   04218 Cellular senescence
    103390394
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    103390394
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:csem01009]
    103390394
Enzymes [BR:csem01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     103390394
Protein phosphatases and associated proteins [BR:csem01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Catalytic subunits
     103390394
SSDB
Motif
Pfam: Metallophos
Other DBs
NCBI-GeneID: 103390394
NCBI-ProteinID: XP_008324454
LinkDB
Position
14
AA seq 490 aa
MSTKEHNKLSTVERPIKAVPYPPGTRLTVKDLYVDGRPSVELLKAHLVKEGRLEEEVALR
IINDGAAILRQEKCMLEVEAPITVCGDVHGQFFDLMKLFEVGGSPSSTRYLFLGDYVDRG
YFSIECRPLPEYFPFKQECKIKYSERVYDACMEAFDCLPLAALLNQQFLCVHGGLSPEIT
CLDDIRKLDRFKEPPAFGPMCDLLWSDPGEDYGSEKSQEHFCHNSVRGCSYFYSYPAGCD
FLMNNNLLSVIRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENN
VMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLNICSDDELMSEGDDTCEG
GAPAVRKEVIRNKIRAIGKMARVFSVLREENECVLQLKGLTPTGTLPLGVLSGGRQTLQS
ATVEAEEARAILRFNPQHRIQSFEEARGLDRINERMPPRRDSKQQESTPSLNNLPASTGP
PDKNGTNAQA
NT seq 1473 nt   +upstreamnt  +downstreamnt
atgtcaacgaaggagcacaataaactctccacggtggagagaccaattaaagcggtgcca
tatccacccgggacgcgcctgacggtcaaagacctgtatgtggatggacggcccagcgtg
gagctgctgaaggcccacttggtgaaggaggggaggctggaggaggaggtggcgctgcgc
atcatcaacgacggcgccgccatccttcgccaggagaagtgcatgctggaggtggaggct
cccatcacagtgtgcggcgatgttcacggccagttcttcgacctgatgaagctcttcgag
gtgggcggttcccccagctccactcgctatctgttcctcggcgactacgtggaccgaggc
tactttagcatagagtgccgacccctcccagagtatttccccttcaaacaggagtgtaaa
ataaagtactcagagagagtgtacgacgcctgtatggaggcctttgactgcctcccactg
gcggctctgctcaaccagcagttcctgtgtgttcacggaggcctgagccccgagatcacc
tgtctggacgacatacggaagctggatcggttcaaggagccgcctgcgttcgggcccatg
tgtgaccttctgtggtcagacccgggggaggactacggctcggagaagagccaggaacat
ttctgccacaacagcgtgagaggctgctcctacttctacagttacccagccggatgtgac
ttcctgatgaacaataacctgttgtctgtaatacgagcacacgaagcccaggacgccggg
tatcgaatgtacaggaagagtcaaaccacaggtttcccgtctttaatcaccatcttctct
gctccgaactacctggacgtctacaacaacaaagctgcggtgctgaagtacgagaataac
gtgatgaacatccgacagttcaactgctctcctcatccctattggctgcccaacttcatg
gacgtcttcacctggtccctgcccttcgttggagagaaagtgactgagatgttggtgaac
gtgttgaacatctgctctgacgacgagctgatgtcagaaggagacgacacctgtgaaggt
ggcgctcctgctgtgaggaaggaggtgatcaggaataagatccgcgcaattggaaagatg
gctcgtgtcttctccgtgctcagagaggagaacgagtgtgtgttgcagctgaaaggcctg
acaccgacaggaactcttcctctgggagttctttccggaggtcgacaaactctacaaagc
gccacggtagaggcagaggaggctcgagccatcctccgcttcaaccctcagcacaggatc
cagagtttcgaggaggcccgaggtctggaccgcatcaacgagaggatgccgccgcgccga
gacagcaagcagcaggagtccaccccgtccctcaacaacctgccggccagcaccgggccc
ccggacaagaacggcaccaatgcccaggcctag

KEGG   Cynoglossus semilaevis (tongue sole): 103391288
Entry
103391288         CDS       T04866                                 

Definition
(RefSeq) serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform-like
  KO
K04348  serine/threonine-protein phosphatase 2B catalytic subunit [EC:3.1.3.16]
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem04010  MAPK signaling pathway
csem04020  Calcium signaling pathway
csem04114  Oocyte meiosis
csem04218  Cellular senescence
csem04310  Wnt signaling pathway
csem04370  VEGF signaling pathway
csem04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:csem00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103391288
   04310 Wnt signaling pathway
    103391288
   04370 VEGF signaling pathway
    103391288
   04020 Calcium signaling pathway
    103391288
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    103391288
   04218 Cellular senescence
    103391288
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    103391288
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:csem01009]
    103391288
Enzymes [BR:csem01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     103391288
Protein phosphatases and associated proteins [BR:csem01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Catalytic subunits
     103391288
SSDB
Motif
Pfam: Metallophos
Other DBs
NCBI-GeneID: 103391288
NCBI-ProteinID: XP_016894909
LinkDB
Position
15
AA seq 499 aa
MTAKGRHKAVPFPLAHRLTMKEVFDSEGRPRVDLLKAHLTKEGRLEEAVALRIIDEGAAI
LRQERTMLDIEAPVTVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYVDRGYFSIECVL
YLWSLKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSEQVYDSCMEAFDCLPLAALM
NQQFLCVHGGLSPEIHTLDLSQKLDRFKEPPAFGPMCDLLWADPLEDFGNEKTQEYFGHN
TVRGCSYFYRDNWVYPAVCEFLQTNNLLSIIRAHEAQDAGYRMYRKSQTTGFPSLITIFS
APNYLDVYNVTAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVN
VLSICSDDELMNDGEEIFDASAAAARKEVIKNKIRAIGKMAKMFSVLREESENVLTLKGL
TPTGMLPSGVLSGGKQTLQSAIRGFSPQHRISSFEEAKGLDRINERMPPRRDTVNSVGLS
MGRMNMGEPNGTDSNSNIQ
NT seq 1500 nt   +upstreamnt  +downstreamnt
atgacagcgaaaggcagacataaagcggtccccttccccctggcccaccggctgaccatg
aaggaggtgtttgattcggagggccggccgagggtagaccttctcaaagctcatctcacc
aaggagggccggctggaggaggctgtggcgttacgcatcatcgatgagggtgccgccatc
ctgcgccaggagcgcacaatgttggacattgaggcaccagtcacggtgtgtggagatatt
cacggccagttctttgacctgatgaagttgtttgaagtaggaggttctcctgccaacaca
cgctacctcttcctgggggactatgtggacaggggctacttcagtattgagtgtgtgttg
tacctgtggtcactgaaaatcctctacccaaagactctctttcttctacggggaaaccat
gaatgtagacatctgaccgaatatttcaccttcaaacaagaatgtaagattaagtactcg
gagcaggtgtacgattcctgcatggaggcgtttgattgcctgcccctggcggccctgatg
aaccagcagttcctctgtgttcatgggggtctttctcctgaaatccacacattggatctc
tctcaaaagttggaccggttcaaagagcccccagcatttgggcccatgtgtgacctgtta
tgggccgaccccctggaagactttggcaacgagaagacccaggagtactttggtcacaac
acagtcagaggctgctcctatttctacagggacaactgggtttacccagcagtgtgtgag
tttctacagaccaacaacctgctgtcaatcatcagagcgcatgaagcacaggatgctggt
taccgtatgtacaggaaaagtcagacgacaggtttcccctccctcatcaccatcttctct
gctccaaactacctggacgtgtacaacgtcacagctgctgtgctcaagtatgagaacaac
gtgatgaacatccgtcagttcaactgctctcctcatccttactggctgccaaacttcatg
gacgtcttcacctggtcattgccttttgtaggagagaaggtgactgagatgttggtcaac
gtcctgagcatctgctccgacgacgagctcatgaacgacggagaagagatcttcgatgcc
agtgcagctgcggcgaggaaagaggtgatcaagaacaagatcagggccatcgggaagatg
gccaagatgttctcagtgctacgggaggagagtgagaacgtgttgaccctgaagggtctg
acccccacagggatgttacccagtggagttctgtctggaggcaaacagacgctgcagagt
gccatccgaggcttctccccgcagcatcggatcagcagcttcgaggaggccaaaggtctg
gaccggatcaacgagaggatgccgcctcgacgcgacaccgttaacagtgtgggcttgtcg
atgggccgcatgaacatgggcgagcccaacgggaccgacagcaacagcaatatacagtga

KEGG   Cynoglossus semilaevis (tongue sole): 103395725
Entry
103395725         CDS       T04866                                 

Definition
(RefSeq) serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform-like
  KO
K04348  serine/threonine-protein phosphatase 2B catalytic subunit [EC:3.1.3.16]
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem04010  MAPK signaling pathway
csem04020  Calcium signaling pathway
csem04114  Oocyte meiosis
csem04218  Cellular senescence
csem04310  Wnt signaling pathway
csem04370  VEGF signaling pathway
csem04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:csem00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103395725
   04310 Wnt signaling pathway
    103395725
   04370 VEGF signaling pathway
    103395725
   04020 Calcium signaling pathway
    103395725
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    103395725
   04218 Cellular senescence
    103395725
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    103395725
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:csem01009]
    103395725
Enzymes [BR:csem01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     103395725
Protein phosphatases and associated proteins [BR:csem01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Catalytic subunits
     103395725
SSDB
Motif
Pfam: Metallophos DUF5378
Other DBs
NCBI-GeneID: 103395725
NCBI-ProteinID: XP_008331737
LinkDB
Position
19
AA seq 493 aa
MKEVFDCEGKPRVDLLKAHLTKEGRVEEAVALRIIDEGATILRQEKTILDIEAPVTVCGD
IHGQFFDLMKLFEVGGSPATTRYLFLGDYVDRGYFSIECVLYLWSLKILYPKTLFLLRGN
HECRHLTEYFTFKQECKIKYSEQVYDSCMDAFDCLPLAALMNQQFLCVHGGLSPEIHTLD
DIKKLDRFKEPPAFGPMCDLLWSDPLEDFGNEKTQEYFSHNSVRGCSYFYSYPAVCEFLQ
SNNLLSIIRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMN
IRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLSICSDDELMNDEDEIFDANAA
AARKEVIKNKIRAIGKMAKMFSVLREESENVLTLKGLTPTGMLPSGVLSGGRQTLQSATI
EAIEAIETPDEDREAIRGFSAQHKISSFEEAKGLDRINERMPPRRDGVNHVGLSMGKMNM
SEANGTDDNSNIQ
NT seq 1482 nt   +upstreamnt  +downstreamnt
atgaaggaggtgttcgactgtgaagggaagccccgcgtcgacctcctgaaggcccacctc
accaaggaaggtcgcgtggaggaagctgtggctctgaggatcatagacgagggcgccacc
atcctgcgacaggagaagaccatcctggacatcgaggctccagtcacagtgtgcggagac
atccacggacagttctttgatctgatgaagctctttgaagttggaggatcaccagcaacc
acgcggtacctgttcctgggggactacgtcgaccgcggctacttcagtattgagtgtgtt
ttgtacctctggtctctgaagatcctttatccaaagactctgtttctactgcgtggaaat
catgaatgtagacatttgactgaatacttcaccttcaaacaagaatgtaaaatcaaatac
tcggagcaggtgtacgactcgtgtatggatgcgtttgactgcctccctctggctgcactc
atgaaccagcagttcctgtgtgtccacggtggactctcacctgaaatacacaccttagat
gacatcaaaaagttggatcgattcaaggagccccccgccttcggccccatgtgcgacctg
ctgtggtctgatcctctggaggactttggtaacgagaaaacccaggaatatttcagccac
aactcagtcagaggctgctcctacttctacagttatccagctgtgtgtgagttcctacag
agcaataatctactgtcaatcattcgagctcatgaagcacaggatgctggttaccggatg
tacaggaagagtcagaccacggggtttccctccctcatcaccatcttctcagcaccaaac
tacctggacgtttacaacaacaaagctgctgtcctgaagtatgaaaacaacgtgatgaac
atcaggcagttcaactgctccccacatccgtactggctgccaaacttcatggacgtcttc
acctggtctctgccctttgtcggggaaaaagtcacagagatgctggtcaacgtgctgagc
atctgctccgacgacgagctgatgaacgacgaagacgagatctttgacgctaacgcagct
gcagctcgtaaggaagtgatcaagaacaagatccgagcgatcgggaagatggccaagatg
ttctcagtcctcagagaggagagtgagaacgtgttgacgctgaagggcctgacccccact
ggcatgctgcccagcggggttctctctgggggcagacagacgctgcagagcgccaccatt
gaagccattgaagccatcgagacacccgacgaggacagagaagccatccgcgggttctcg
gcccagcacaagatctccagcttcgaggaggccaaaggtctggaccgcatcaacgagcgc
atgccacctcgcagggacggcgtcaaccacgtgggtctgtccatgggaaagatgaacatg
tcggaggcgaacggcaccgacgacaacagtaacatccagtga

DBGET integrated database retrieval system