KEGG   Cynoglossus semilaevis (tongue sole): 103387239
Entry
103387239         CDS       T04866                                 

Gene name
tp53
Definition
(RefSeq) cellular tumor antigen p53
  KO
K04451  tumor protein p53
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem04010  MAPK signaling pathway
csem04110  Cell cycle
csem04115  p53 signaling pathway
csem04137  Mitophagy - animal
csem04210  Apoptosis
csem04216  Ferroptosis
csem04218  Cellular senescence
csem04310  Wnt signaling pathway
csem05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:csem00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103387239 (tp53)
   04310 Wnt signaling pathway
    103387239 (tp53)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    103387239 (tp53)
  09143 Cell growth and death
   04110 Cell cycle
    103387239 (tp53)
   04210 Apoptosis
    103387239 (tp53)
   04216 Ferroptosis
    103387239 (tp53)
   04115 p53 signaling pathway
    103387239 (tp53)
   04218 Cellular senescence
    103387239 (tp53)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    103387239 (tp53)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:csem03000]
    103387239 (tp53)
   03036 Chromosome and associated proteins [BR:csem03036]
    103387239 (tp53)
   03400 DNA repair and recombination proteins [BR:csem03400]
    103387239 (tp53)
Transcription factors [BR:csem03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   p53
    103387239 (tp53)
Chromosome and associated proteins [BR:csem03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     103387239 (tp53)
DNA repair and recombination proteins [BR:csem03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    103387239 (tp53)
SSDB
Motif
Pfam: P53 P53_tetramer CEP1-DNA_bind
Other DBs
NCBI-GeneID: 103387239
NCBI-ProteinID: XP_008320010
UniProt: A0A3P8UNQ6
LinkDB
Position
1
AA seq 377 aa
MGEPSGFTPSQEDTFRELWGVVTASIDVGMAPQRAPQHEQWQVEAPIEALASTAFLLNDQ
ELHEQFDEDLFDTLNSEAMMTKGSDFVTPPASTVPVTTDYPGEYEFKIHFQKSGTAKSVT
STYSEQLNKLFCQLAKTSPVSMQLNKEPPHGAVLRATAVYKKTEHVADVVRRCPHHQNED
SAEHRSHLIRVEGSQRAQYFEDGHTKRQSVTVPYEPPQPGAEMTTILLSFMCNSSCMGGM
NRRPILTILTLETPEGGVLGRRCFEVRVCACPGRDRKTEEENSTKTQNGIKQTKKKKSTL
APDVTPAKKLKTSSSADEEDKEIFTLHIRGKKRYELLKEINEGLDLADKKRKKQAKKHEV
PATGKRLMQQSERSDSD
NT seq 1134 nt   +upstreamnt  +downstreamnt
atgggagagccaagtggtttcacccccagccaggaggataccttcagagagctgtgggga
gttgtgactgcctctatagatgtaggcatggcaccacagagagccccccaacatgagcaa
tggcaggttgaagctccaatcgaggcactagcctctacagcttttctcttgaatgaccag
gaactgcacgagcagtttgacgaggatctctttgacaccctgaactcagaggcgatgatg
acgaaggggagcgattttgtcactccccctgcctccactgttccggttactacagactat
ccaggggaatatgaattcaagatccacttccagaagtctggcaccgccaagtctgtcact
tctacttattcagagcaactcaacaagttgttctgccagctggcaaaaaccagcccagtg
tctatgcagttgaacaaggagcctcctcatggtgctgtcctcagagccacggcagtttac
aagaagacagagcatgtggctgacgtggtgcgcagatgcccccatcaccagaacgaagat
tctgctgagcatcgcagccacctaatcagagtggagggcagccagagagctcagtatttt
gaagatggtcacacaaagagacaaagcgtgacagtcccctatgagccacctcagccgggt
gcagagatgaccaccatcctgctgagcttcatgtgcaacagctcctgcatgggtggaatg
aaccgcagacccatcctcaccattctgaccctcgagactccagagggaggggtgctgggc
aggagatgcttcgaggtgcgtgtctgtgcatgtcctggaagagaccgcaagactgaggag
gaaaacagcaccaagacgcagaacgggatcaagcaaaccaaaaagaaaaagagcaccctg
gctcctgacgtgaccccggcaaagaaactgaagacttcctcaagtgcagatgaggaagac
aaggagatctttacccttcatattcggggaaaaaagagatatgagctactcaaggagatc
aatgaaggtctggacctggctgacaagaagcgcaagaaacaggccaagaagcacgaggtt
cccgccactggaaaacggctgatgcagcaaagcgagcgcagcgacagtgactga

DBGET integrated database retrieval system