KEGG   Cynoglossus semilaevis (tongue sole): 103388382Help
Entry
103388382         CDS       T04866                                 

Gene name
setd2
Definition
(RefSeq) histone-lysine N-methyltransferase SETD2
  KO
K11423  histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:csem00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    103388382 (setd2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:csem03036]
    103388382 (setd2)
Enzymes [BR:csem01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     103388382 (setd2)
Chromosome and associated proteins [BR:csem03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     103388382 (setd2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SRI SET WW
Motif
Other DBs
NCBI-GeneID: 103388382
NCBI-ProteinID: XP_008321555
LinkDB All DBs
Position
13
AA seq 2625 aa AA seqDB search
MDTLLSEEGSGASVKVDGLSNAALIKTLSPRVMLSNHFLPKGTKTKVNLEDQSRQKVSFS
FAQTKKPLQSPLFTPSSSEKPAVESLAALSQSTPDNGGQCTDSNNEQKQTSIVPKPAPET
PQIPLSSATKLKPDLGKMHFKKQILSVSVSEDKPTSVIPEESHSTELQVLQMSASESETK
FLTPPLQNIDNVNPSENTYIDSSEIRLSLSLKKSTASSGKDGDTSGTAEVENKISERKTR
PDSDGDSAHMSSSRQSDSKSRTNLESKVKDVKKSSSSSHLTDKEKCSSKRSENYERSSSY
SKSDRDSRYTSSRSARSDKERRRTRSRSRSRSRGPRTSSSHSRSERSRGDRGSRSERSYY
YDSDRRSHRSSPRRERKSSRSRTDRVRDSSDSEEDHRKTRTRTSDSSRSSVYSSSHKESR
SSSYSKSDKAYKSIDPSHSSEIDRKSLFLKSERTSKRLSDSDQQRKWSPDLDSSYRKSSI
HSKSDSSSKCSFSSIHTHSNTNDKYHKNSSSESEADHKEKSQASERSSVSDEKSKDPLQK
NNRLDHKQMTPCSFSLKATGHDRQSDDLSHSPDKTSPCPTIADSYRVDSELFNQLLESKD
SCTQNVLEEFSVKKTDETKSGFEVVNKNASTTSSNSLKHLDATLENLNNVKDSLSSNKWP
HVNLHEPSCNKSDGAVLIQDKKIVDGLPEPKSLPGKDEPAMDNMYEETKSEMDEPNTLEK
EPDTSLPLYGESTHQENMNPNQVTVKKSGGKKSRWDIVGQSSHDSDQSHSTLIAESKTTA
IKVISVKQIEVTTDNSQQDFKIRDDIPPETEKYFMLGKHTQISKHECGSDSMSMDYYNTD
QNGPNQTRTQTHPCDLEIISSVKTKTNETLHSSDASQVDSTANLTSWDGNNYTEKSANVD
NKNYLVERPSAHLDALRGQSEASDSDNSEYDSDCGEAIKRLHSVVVVPKNSSLGLDAQDS
GASQRSTNNSGLQSHNFRANIESPNITNQISSQRRPLSPSVLFGGNDSSSSSMLCQSQSN
MIDSTSPSEGSSAISVLSHVSDLSSAHRTATDSAHSFGHLGQYRIEQKQHSISNKTEYIY
AHHQLRDLSNNDNFSNKNRVITGWGFTQSEQPSSTYQQPDSSHGPQLPITKLSGISPKVQ
EHEQSNHQWNHQSPHMQTSRTPYLHAHELYRDLVGEIHPDSLTNDHGDCSTDKCSNLGRS
SVESREPHTAGSSSSVQGHEISSNSRGSVIPDPPRDVNFRPHRGRGPPKKRRQEFESDSD
NEAEAGPAGKKDRHGDVDTTREPAVKAEVFRPSLTLQDFQDALRWKDQAKSKKMPPYFDL
IEENLYLTERKKSKSHRDIKRMQCECPMLSREERSKGASACGEDCLNRLLMIECSSRCLN
GVYCSNRRFQNKQHAGFDVILTEDKGWGLRAAKDLTANTFVLEYCGEVLDHKEFKTRVKE
YARNKNIHYYFMSLKNNEIIDATLKGNCSRFMNHSCEPNCETQKWTVNGQLRVGFFTTKA
VSAGTELTFDYQFQRYGKEAQKCFCGASSCRGFLGGENRVSVRAAGGKMKKDRNRKSALT
TVDEELEVLLENGEGLYDEKQVVSLCRLMVRVETFEQKLTCLKLIRDTQNPSCLKQFLDH
HGLSLLWILMVELSEAKGNSVNNIKLQSEIMKALAVLPISTKNMLEESRVLTFIQRWAQT
KALPQPAEMDGYSSENTSRAQTPLNTPDGSSAKMGPDLDVDSSKPAVYRRLKIISENSLD
SALSDASKASDGKEDEEEDDEEEDDSSQTGASESKELKSEPLCETSDPTKDAVEDSEEKD
KNQQEESLSSTNQDQSQNQEIEIRLNVNTEDENTESKDSTPEDLKDGDLKDVDLKDGDLK
DGDLKDGDLKDGDLKDEDLKDGDLKEHLVEQSILPVSESTEIESDQPAVKCPELENESIQ
TDVTDHLNEQPSEQMEVQSESQETDKAPLSSNPQPGESTADIPQNSAIPETSMPSEIPLA
PIDPSVIGTPSQDEEEGVSDVESERSQEPQLTTVDICGMAARLLDSWKDLKEVYRIPKKS
QVEKEPSDRSRDRDTALTPRATSGSRERERERERERDRERDYDRDRDWDRDRDRERDRDR
GSEKALRSAERRRRRSVSPPPSSSSSSYERSSRRTEERFDPASNSKTPRGVGGKERNKLS
TEERRKLFEQEVAQKEAQKQQQQQQLQQQQQQQLQTMAYDPNLAYASSSGFIHYPPGYPI
QTFVDPTNPNAGKVLLPTPSVDPALSYDQTPAPQQLLSDMALTSPSSTSQATSVSSLSHH
ITTTSITAGTPQQQQYAPTNVATQDGGVAVLSVAAQTAPQVQSQQSYTTLWDPNTQQTVT
VQTQPTQQYATAPAQAQAQTAIYYQGQPCQTIYSIPTAYPQANTPVIQAYTESTASYLHG
QPVYPGHQQGVVVQQGGTVTTIVTSQTVQQEMIVPNNVIDLPPPSPPKPKTIVLPPNWKV
ARDPEGKIYYYHIVTRQTQWDPPTWEGSTDNTSVDHESEMDLGTPTYDENPSKFSTKTAE
ADTSSELAKKSKETFRKEMSQFIVQCLNPYRKPDCKLGRISNTEDFKHLARKLTHGVMNK
ELKACTNPEDLECNENVKHKTKEYIKKYMQRFGSVYRPKEDTDVY
NT seq 7878 nt NT seq  +upstreamnt  +downstreamnt
atggacactttgctaagtgaggaggggagtggtgcttcggtgaaggttgacggtctatcg
aatgcagctctaatcaaaaccctatctcccagagtgatgctgtcgaatcatttcttgccc
aaagggaccaagacaaaggtcaacctggaggatcagagtcgtcagaaagtgtccttcagc
tttgcacagaccaagaagccgttgcagagccccctctttaccccttccagttctgaaaag
cctgctgtcgaatctctagctgccttgtcacagtcaaccccagacaacggagggcagtgt
accgacagcaataatgaacaaaagcagacatcgatagtgccaaaaccagcgccagagacg
cctcaaataccactctcctcggccactaaattaaaacctgacttaggaaagatgcatttc
aagaagcaaattctaagtgtctctgtttctgaagataaacccacatctgttataccagaa
gagtcgcattcaactgaactacaggttttgcagatgtcggcaagtgagagtgagactaaa
ttcttaacacctccgctacaaaatattgacaatgtcaatccatctgagaatacgtatatt
gattcctcagagattagattgtccttgagcctcaagaagtcaactgcttcctcaggaaaa
gatggggatacttcaggcactgctgaagtggaaaacaagatatcagaaaggaaaaccagg
ccagattctgatggagattcagcacacatgtcttccagtcgccagtctgactccaaaagc
agaacaaacttggagagcaaggttaaagatgtaaaaaagtcttcctctagctcacatctg
acggataaggaaaaatgctcctctaagcgttcagagaattatgaaaggtcgtcgagttac
tcaaaatcagaccgtgattctagatatacatcatctcgatcagctcgttcagacaaagaa
cgcagaaggacgaggtcaaggtcacgatctcgatcgcgtgggcctcgaactagttcgtct
cactccagatcagaaaggtccagaggagacagagggtcacgctctgagaggtcgtactat
tatgattctgaccgtaggtcacacagaagctctccacgcagagagaggaaatcttcgcga
tctcgcactgaccgagtgagagacagttcagactcggaggaagaccataggaagacacgg
acgaggacaagtgattcaagcagatcctctgtctactcaagttctcataaagagtcgaga
tcatcttcttactcaaaatctgataaggcctacaagtccatagatccttcacattcttca
gaaatagatagaaaatcactatttttaaaatctgaaaggacttctaagcggttatcagac
tctgatcagcagcgcaaatggtcacctgatctagactccagttaccgtaaatctagcatt
cattcaaagtctgacagcagtagcaaatgctctttctctagcatacatacccattctaat
acaaatgacaaataccataaaaacagctccagtgagtcagaggcagatcacaaggaaaaa
tcacaggcctctgagagaagctctgtctctgatgagaagagtaaagatccccttcagaaa
aacaatagattagaccacaaacagatgacaccttgtagtttttctttgaaagccactgga
catgatagacagtcagacgacttgtctcacagccctgacaaaacatcaccctgtccaacc
atcgcagacagttatcgggttgacagtgagcttttcaatcagcttcttgaatcgaaagat
tcatgtacacagaatgtgttggaagaattttctgttaaaaaaacagatgagactaaatct
ggttttgaagttgtaaataaaaatgcttccacaacatcgagtaatagcctcaaacatctt
gatgccaccctggaaaacttgaacaatgtgaaggatagcctttcatccaataaatggcca
catgtgaatttacatgaaccttcgtgcaataaatcagatggtgcagtgttaatacaggac
aagaaaattgttgacggtttaccagagccaaagtccttacctggtaaagatgaacctgcc
atggataacatgtatgaggagaccaaatcagagatggatgagccaaatacacttgaaaag
gagcctgacacaagtctgcccctatatggagagtcaacacatcaggaaaacatgaacccg
aatcaagttactgtcaaaaagagtggtggaaaaaagtccagatgggatattgttgggcag
agctcccacgacagtgatcaatcacacagcacgttgattgcagagagtaaaactactgct
attaaagtgatctctgtcaaacaaatagaggttactactgacaacagccaacaggacttc
aaaattcgagatgacattccaccggaaactgaaaagtatttcatgctggggaaacacact
caaatctctaagcatgagtgtggttcagacagcatgtccatggattattataacacggat
caaaatgggcccaatcagacaagaacccagacacatccatgtgatttagaaatcattagt
tctgtgaagacaaaaacaaacgagactctacacagcagtgatgcgtcccaagttgattca
actgcaaatctcaccagctgggatggaaacaattacacagagaaatcagcaaacgttgat
aataaaaactatttggtcgagaggccttcagctcatcttgatgcattacgaggacagagc
gaggcaagcgatagtgacaactcagaatatgactccgattgtggggaggctataaaacga
ttgcactcggtggtggtggtgccaaagaattcttccttaggattggatgcacaagactcg
ggagcgtctcaacgttctactaataattcaggactacaaagtcataattttagggctaac
atagagagccctaacattacaaatcaaatcagctcgcagagaagaccactgagtccgtct
gttttatttggtggaaatgactcatccagcagcagcatgttatgtcagtcccagagtaac
atgatcgatagcacgagtccctctgagggttccagtgccatcagtgtcctgtctcacgtc
agtgatctttccagtgcccacaggactgcaacagattctgcacacagctttggtcatttg
ggacagtatcgaattgagcagaaacagcatagcataagcaacaaaactgaatacatttat
gcccatcaccaacttcgggacttatccaataatgacaattttagtaacaagaatagagtc
attacaggatggggatttacccaatcagagcagccaagtagtacatatcagcaacctgac
agcagtcatggaccacagttaccaatcactaaactgtcaggaatctctcccaaggttcag
gaacatgagcagagtaaccaccaatggaaccaccaatctccacatatgcagacaagcagg
acaccataccttcatgcacatgaactttatcgggatctggttggggaaattcatcctgat
tccctaaccaatgaccatggtgattgcagcacagacaaatgttcaaatttaggcaggtca
tctgttgaatccagggaacctcacactgcagggtcatcgagctccgtgcaaggtcatgaa
ataagtagcaacagcaggggttctgttatccctgaccctcccagggatgtcaactttaga
ccccacagaggcaggggtccacccaaaaaaaggcgtcaagagttcgagtcagactcggac
aacgaggcggaggctgggcctgcgggaaaaaaagatcgccacggagatgttgacaccact
cgggaacccgctgtcaaagccgaggttttccgtccgtcactcactctgcaagactttcag
gatgccctcagatggaaagatcaggccaaatccaaaaagatgcctccgtactttgacctg
attgaggaaaacctgtatttaacagagagaaagaagagcaaatctcaccgagacatcaag
aggatgcagtgcgagtgcccaatgttgtccagagaggagcgatcgaagggagcgtcagcg
tgtggggaagactgtttaaatcgactgctgatgattgaatgctcgtcacgctgcctgaat
ggagtctactgctcgaatcgtcgctttcagaataagcagcatgcaggttttgatgttatc
ctgacagaagacaagggttggggactacgtgcagctaaagacttgactgcaaacaccttt
gtgcttgaatactgtggtgaggtcctggaccataaggagttcaaaacaagagtgaaagaa
tatgctcgcaacaaaaacattcattattatttcatgtccctgaaaaataacgagatcatc
gatgccacactaaagggcaactgctctcggtttatgaaccacagctgtgagcccaactgt
gagacccaaaagtggactgttaatggccagctcagagttgggttctttaccaccaaggct
gtcagtgcaggaactgaactgacatttgattatcagtttcagagatacggcaaagaggca
cagaaatgcttctgcggtgcatccagctgcagaggcttcctgggtggagaaaaccgcgtc
agtgttcgagctgctggaggaaagatgaagaaagaccgcaatcgaaagagtgccctgacc
acggttgatgaagaactggaggtgttactggagaatggagaaggcctgtatgatgagaag
caggtggtgtctctctgcagactcatggttcgagtggaaacatttgagcagaagctcacc
tgtctcaagcttatccgagacacccaaaatccatcgtgcctgaagcagttcttggaccac
catggattgtctttgctgtggattcttatggtggagctttctgaagctaaaggcaacagc
gtcaataacatcaaactgcagtcagagattatgaaggctctggccgtccttcccatctct
actaagaacatgctggaggagagcagggtcttgaccttcattcaacgatgggcccagact
aaagctctccctcaacctgctgagatggacggctattccagcgaaaacacctcccgtgct
caaacgccccttaacaccccagatggttcctcggccaaaatgggcccagatctggatgtc
gacagctccaaacccgctgtgtaccgccgcctcaaaatcattagcgaaaacagtctggac
agcgcactgtctgacgccagcaaagcatctgacggtaaggaggacgaggaggaggacgac
gaggaagaagatgactcctcacaaactggagcttctgagagcaaagagcttaagtcagag
ccactctgtgaaacttcagatccaacaaaagatgctgttgaagattcagaggagaaggac
aagaaccagcaggaggaatcactgtcctcaaccaaccaggatcaatctcagaatcaggaa
atagaaatacggttgaatgtgaacacagaagacgagaacacagagagcaaggactcaaca
cctgaggacctgaaagatggagacctgaaggatgtagacctgaaagatggggatctaaag
gatggagacctgaaggatggggatctaaaagatggagacctgaaggatgaagacctaaag
gatggagatctgaaggaacatttagtggaacagagtattttgccagtgtcagagagcaca
gaaattgaaagtgaccagcctgctgttaaatgtccagagttggagaacgagtccatccaa
acagatgttaccgatcatttgaatgagcagccatcagaacagatggaagtgcagtcggaa
tcacaagagactgacaaagctcctcttagcagcaatccacaacctggtgaatccactgct
gatatcccccaaaactctgcgatcccagagaccagtatgccttcagagatcccactggcc
cccatagatccatctgtgatcggaactccttctcaagatgaggaggaaggtgtctcagat
gtagagagcgaaaggagccaagagccgcagcttactactgtggatatttgtggcatggct
gccaggctactggacagttggaaggatctaaaagaagtgtacagaataccaaagaagagt
caagtggagaaagagccaagtgatcgcagcagagacagagacaccgctttgacaccacgc
gcaacatctggtagcagagaacgtgaaagggagcgagagagggagagagaccgtgagcgg
gattatgaccgtgatcgagactgggaccgagacagggatagagagcgtgatcgtgaccga
ggctcagaaaaagcactccgcagcgcagaaagacggagaaggcgatctgtttccccgcca
ccatcttcctcatcatcttcatacgagagaagcagtcgtcgcactgaggaacggtttgat
ccagctagcaatagcaagacaccaaggggagtcgggggcaaggagcgcaataagttgtca
acagaagaacgcagaaaactgtttgagcaggaggtggctcaaaaggaagcccagaaacaa
caacaacaacaacaacttcagcagcagcaacaacagcagcttcaaactatggcttatgac
cctaatctggcctacgcctccagctctgggtttatacactacccccctggatatccaatc
cagacctttgtggatccaacaaacccaaatgcaggcaaagtgctgctccccaccccatct
gttgacccggccttgagctacgatcagacccctgctccgcagcagcttctgtcagacatg
gccctgacctctccgtcctccacctcccaggccacttcagtttcaagtctgtctcaccac
atcacaaccaccagcatcacagctgggacccctcagcagcagcagtatgcgccgacaaat
gtagcaacccaggacgggggtgtagctgtcctctctgtcgccgcacaaactgccccccag
gtacagagccagcagagctacaccactctctgggaccccaacactcagcagactgtgact
gtgcagacgcagccaactcagcagtatgccacagccccagcacaggcccaggcacagaca
gctatttattaccaaggtcagccgtgccaaaccatctacagtatccccactgcttacccc
caggccaacactccagtcattcaggcttacactgaatctacagccagctaccttcatggc
cagcctgtatatcctggccatcagcagggagtggtggtgcagcagggaggcaccgtcacc
accattgtcacatcccaaactgtgcagcaggaaatgattgtacccaacaatgtgatagac
cttcctccaccttctccccccaaacccaaaaccattgtcctacctcctaactggaaagtc
gcccgggaccctgaaggcaagatctactactaccacatcgtcacaaggcaaacacagtgg
gatcctccgacatgggaaggaagcaccgacaacactagtgtggaccacgaatctgagatg
gacctgggaacgcccacgtacgacgaaaacccttccaagttctccacaaagacagctgag
gcggacacttccagtgagctggctaaaaagagtaaagagacgtttcgcaaagagatgtcc
cagttcatcgtgcagtgtctaaatccttaccgaaagccagactgcaaattgggacgtatc
agcaacacggaggacttcaaacacttggctcggaagctcactcatggagtaatgaacaag
gagctgaaggcgtgcaccaaccccgaggacctggagtgtaacgagaatgtcaagcacaag
actaaggagtacatcaagaagtacatgcagagattcggctctgtgtaccggcctaaggaa
gacacggacgtgtattag

DBGET integrated database retrieval system