KEGG   Cynoglossus semilaevis (tongue sole): 103388535Help
Entry
103388535         CDS       T04866                                 

Definition
(RefSeq) coagulation factor XIII A chain-like
  KO
K03917  coagulation factor XIII A1 polypeptide [EC:2.3.2.13]
Organism
csem  Cynoglossus semilaevis (tongue sole)
Brite
Enzymes [BR:csem01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     103388535
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_N Transglut_C Transglut_core
Motif
Other DBs
NCBI-GeneID: 103388535
NCBI-ProteinID: XP_008321802
LinkDB All DBs
Position
1
AA seq 742 aa AA seqDB search
MAEQGSTPSPSDAPPAPSGPPPKVTTLGRAAAPMASSNSDFTEVPEFEVFGIPGPRGLPP
LTEYLDILDVDMMKKPEEINKMQHHTSYYHSDFLIVRRGQEFQVNITFNRPYDSDRDKIA
VEFVIGSSPSYSKGTYIPVFPTKERQSSWEGRIIDQSGNSVTMGITPSANCVVGKYHMFV
AVATPFGIRRTRRDKSRDLYILFNPWSPDDAVFLNDETEREECVMTEMGIIYHGSYDDVS
ERNWNYGQFNYGVLDACLYIMDRANMPIVNRGDPIKVTRKASAMLNSRDDDGVLVGNWSG
DYTFGVAPTSWTGSTDILLGYASSKMPVCYAQCWVYAAVFNTFLRCLGIPARVVTNYFSA
HDNDGNLKTDIILDENGKIDRNRTRDSIWNYHCWNECYMSRPDLPAGFGGWQVVDATPQE
TSDGMYRCGPASVQAIKHGQICYPFDAAFVFAEVNSDVVFYSRRKDGTMDPVRVNHSHVG
RMVLTKTPLKMTRRDITDQYKFPEGSTEERTVLEKAEEYGCEREKSEPPVADVDLVLPTM
EISLGDDFEFEVEFINRSNQQRTVDAYVIGSVVYYTGVTSSEFLFDTPTVEIKPNMSKKE
LVEVESKSYMRDLVEQANLNFIVTGKVNETGQIVTAMKVVTLRNPKIMVEVSGPGKVNEE
MMATVQFTNPFSFSLDGVYIRMEGPGVMLPKSKYYSMITGGSSLTWTEFFTPQRSGTTRV
MVTLDCPALRQVSGQASITIQA
NT seq 2229 nt NT seq  +upstreamnt  +downstreamnt
atggctgaacaaggctccacccccagcccctctgatgccccacctgcacccagcggacct
ccgcccaaggtgacgaccctcgggcgtgcggccgctcccatggccagctccaactcggac
ttcaccgaggtccctgagtttgaggtctttggtataccaggcccacgaggacttcctcct
ctgacggagtatctggacatcttagacgtggacatgatgaagaagcctgaggagatcaac
aagatgcagcatcacacctcatactatcactctgactttctcatcgtccgccgaggacaa
gagttccaggtcaatattaccttcaaccgaccctacgactctgaccgagacaagattgct
gtggaatttgtcatcggctccagcccctcgtacagtaaaggcacctacatccccgtcttc
cccaccaaggaacgtcagagttcctgggaaggccgcatcatcgaccaatcaggtaactcg
gtcaccatgggcatcactccgtcagccaactgtgttgtgggaaagtaccacatgtttgtg
gccgtggctacaccttttggcattcgcaggaccagacgtgacaagagccgtgacctgtac
atcctctttaacccctggtcaccagatgacgctgtgtttctgaacgatgagacggagaga
gaggagtgtgtgatgacggagatgggaatcatctaccacggttcttatgatgacgtgtca
gagagaaactggaactacggacagttcaactatggagtcctggatgcctgtctgtatatc
atggacagagctaacatgcccatcgttaacagaggagatcccatcaaggtgaccaggaag
gcctctgctatgctcaactctcgtgacgacgacggtgtgttggttggtaactggagtggc
gactacaccttcggagtggcgcccacatcctggacaggcagcaccgacatcctgctgggc
tacgccagcagcaagatgccggtctgctatgctcagtgctgggtctacgctgcagtcttc
aacaccttcttgcgctgtctgggtatcccggcccgtgttgtcactaattacttctccgct
catgataacgatggaaacctgaagactgacatcatcctggatgagaatggcaagattgac
cgcaatcgcaccagggactccatctggaactatcactgctggaacgagtgctacatgtcc
agaccagacctcccagcaggctttgggggctggcaagtggtggacgccacaccccaggag
accagtgacggtatgtacagatgtggtccagcctcagtccaggccatcaaacatgggcag
atctgctacccctttgatgctgcctttgtgtttgctgaggtgaacagtgacgtggtcttt
tattcccggaggaaagacgggaccatggatcctgtgagagtaaaccacagtcacgtgggt
cgcatggttttgaccaaaacgccattaaagatgacccgccgtgacatcactgaccagtac
aaattccctgaaggaagtacagaggagcgaactgttctggagaaggcagaggagtacggc
tgtgagcgagagaagtccgagcctcctgtggctgacgtggacctggtcctgcccaccatg
gagataagtctgggcgacgactttgagttcgaggtggagttcataaaccgcagcaaccag
cagcgtaccgtcgacgcctacgtcatcggtagtgtggtgtactacactggagtcaccagc
tctgagttcctgttcgacacacccacggtggagatcaagcccaacatgtctaagaaggag
ttggtggaggtcgagtctaagagctacatgagggatttggtggaacaggccaacctgaac
ttcatcgtcacagggaaggtcaatgagactgggcagatcgtcacggccatgaaagtcgtc
accttgcgaaaccccaaaatcatggttgaggtctctggtccaggaaaagtcaatgaagag
atgatggcaacggtccagttcaccaaccctttctccttcagcttggatggcgtctacatt
cgcatggaaggacctggggttatgttgcccaagtccaaatattacagtatgatcacagga
ggctcgtctctgacctggaccgagtttttcaccccacaaaggagcgggaccactcgggtg
atggtgaccctggactgtcctgctctcaggcaggtctctggccaagcgtccatcaccatc
caggcctga

DBGET integrated database retrieval system