KEGG   Cynoglossus semilaevis (tongue sole): 103388554Help
Entry
103388554         CDS       T04866                                 

Definition
(RefSeq) zinc finger and BTB domain-containing protein 16-A
  KO
K10055  zinc finger and BTB domain-containing protein 16
Organism
csem  Cynoglossus semilaevis (tongue sole)
Brite
KEGG Orthology (KO) [BR:csem00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:csem04121]
    103388554
Ubiquitin system [BR:csem04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     103388554
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-H2C2_2 zf-C2H2_4 zf-C2H2 zf-C2HE
Motif
Other DBs
NCBI-GeneID: 103388554
NCBI-ProteinID: XP_016893207
LinkDB All DBs
Position
13
AA seq 216 aa AA seqDB search
MGYPGFYPYHTQNRCTAAAGMGSIIKQGLLRRKRIRRASNGGVQDGHSFHQVPKTSPDCI
KDCQNCSSSLTADSAPRNAASTLSGKVCAGCRFCRKQYGLKREPQSKQHDQRGDKPYQCR
HCPKKFSLKHQLDTHHRVHTGEKPFECRLCGQRSRDYSAMIKHLRTHGGATPYRCTLCLE
FCSSLAAMQKHIRNHAMQEFPPDWSISSTYLYISHI
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgggctacccgggcttctatccgtatcacacacagaaccgatgcactgcagcagcaggt
atgggcagcataataaaacaaggactgttaaggagaaaaaggattcgcagagcctccaat
ggtggtgttcaagatggacacagttttcatcaagtccctaaaacgagcccagactgcatt
aaagactgccaaaactgcagttcaagtctcactgctgattctgcaccacggaacgcagcc
tctacactatcaggtaaagtctgtgcaggctgtcgattctgcagaaaacaatatgggcta
aagcgtgagccacaatccaagcagcatgaccagagaggagacaaaccctaccagtgccga
cactgccccaaaaagttcagtcttaaacatcaactggacacccaccacagggtgcacact
ggggagaagccctttgaatgccgtttatgtgggcagcgctcacgggactactcggccatg
atcaaacatctgcgaacccatggcggggccacgccgtatcggtgcacattgtgtctggag
ttctgcagcagcctggccgccatgcagaaacacatcaggaaccatgccatgcaggagttt
ccccctgactggagcatcagcagcacctacctgtacatctcccatatctga

DBGET integrated database retrieval system