KEGG   Cynoglossus semilaevis (tongue sole): 103388719Help
Entry
103388719         CDS       T04866                                 

Gene name
aldh2
Definition
(RefSeq) aldehyde dehydrogenase, mitochondrial
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem00010  Glycolysis / Gluconeogenesis
csem00053  Ascorbate and aldarate metabolism
csem00071  Fatty acid degradation
csem00280  Valine, leucine and isoleucine degradation
csem00310  Lysine degradation
csem00330  Arginine and proline metabolism
csem00340  Histidine metabolism
csem00380  Tryptophan metabolism
csem00410  beta-Alanine metabolism
csem00561  Glycerolipid metabolism
csem00620  Pyruvate metabolism
csem01100  Metabolic pathways
Module
csem_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:csem00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    103388719 (aldh2)
   00053 Ascorbate and aldarate metabolism
    103388719 (aldh2)
   00620 Pyruvate metabolism
    103388719 (aldh2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    103388719 (aldh2)
   00561 Glycerolipid metabolism
    103388719 (aldh2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    103388719 (aldh2)
   00310 Lysine degradation
    103388719 (aldh2)
   00330 Arginine and proline metabolism
    103388719 (aldh2)
   00340 Histidine metabolism
    103388719 (aldh2)
   00380 Tryptophan metabolism
    103388719 (aldh2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    103388719 (aldh2)
Enzymes [BR:csem01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     103388719 (aldh2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 103388719
NCBI-ProteinID: XP_008322067
UniProt: A0A3P8VU60
LinkDB All DBs
Position
13
AA seq 518 aa AA seqDB search
MLRSVLSRSFPGFGRLSLRPFSAAAVPAPSGQPEVHYNKLFINNEWHDAVSGKSFPTINP
STGEVICQVAEADEADVNKAVKAAKDAFKLGSPWRRMDASHRGLLLNRLADAIERDSAYL
AELETLDNGKPYAVAYMVDLPNVVKCLRYYAGWADKWEGKTIPIDGDFFCYTRHEPVGVC
GQIIPWNFPLLMQSWKLGPALATGNTVVMKVAEQTPLTALYVASLIKEVGFPEGVVNILP
GMGPSAGAAIARHMDVDKVAFTGSTEVGHLIQQASGSSNLKKVTLELGGKSPNIILSDAD
MEHAVEQAHFALFFNQGQCCCAGSRTYVQADIYDEFMERSIERAKKRVVGNPFDLKTEQG
PQVDQEQFNKILGYISSGKREGAKLMCGGGVAADRGYFIQPTIFGDVKDNMTIAREEIFG
PVMQILKFKTLEEVVERGNDTKYGLAAAVFTKDLDKANYLSSALRAGTFWINCYDVFGAQ
APFGGYKASGSGRELGEYGLEAYTEVKTVIMRVPQKNS
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgcttcgatccgtcctctcacgctcttttccaggatttggacgtctgtcattacgtccc
ttttccgccgccgctgtccccgcacctagtggtcagcccgaggtccattacaacaagctg
ttcatcaacaatgagtggcacgatgcagtgagcgggaaatcctttcctaccatcaaccca
tccacaggagaggtcatctgtcaggttgcagaagcagatgaggcagatgtaaacaaagca
gtgaaagcagcaaaagatgcctttaaattgggatcaccatggcgacggatggatgcctca
catcgcggcctcctgctcaaccgccttgctgatgccattgagagggattctgcctatctg
gctgaactggaaacccttgacaatggaaagccatacgctgtcgcctacatggtggatctg
cccaatgttgtcaaatgtctcaggtactacgctggctgggctgacaagtgggagggaaag
accattccaatcgacggggactttttctgctacaccagacatgaacccgtcggagtgtgt
ggacagatcattccgtggaacttccctctcctaatgcagtcctggaagctgggcccggcc
ctcgccaccggcaacactgtggtgatgaaggtcgcggagcagacgcccctcacagctctc
tatgtggccagtctgatcaaagaggtgggcttccctgaaggagtcgtgaatatcctgccc
ggcatgggaccttcagcaggtgctgccattgcgaggcacatggatgttgacaaggttgct
ttcacaggatctacagaggtgggtcatctgattcagcaggcctcaggcagcagtaacttg
aagaaggtcactcttgagctgggaggaaaaagccctaacatcatcttgtctgatgctgac
atggaacacgcggtggaacaggcccactttgccctgttctttaaccaaggccagtgctgc
tgcgccggctctcgtacctacgtccaggcagacatttatgatgaatttatggagcgcagc
attgagagagcgaagaaacgggtggtgggaaatccctttgacctgaagactgagcaggga
cctcaggtggaccaggagcagtttaacaagattctgggctacatcagcagtgggaagaga
gaaggagccaagctcatgtgcggcggaggagtggcagcagaccgaggctacttcatccaa
cctacaatattcggagatgtcaaggacaacatgaccatcgccagagaggagatctttggg
ccagtgatgcaaatccttaaattcaaaaccctcgaggaggtggtggagagaggcaacgac
accaaatatggcctggcagctgccgtgtttacgaaggacttggataaggccaactacctt
tccagcgctctccgtgctggaacattctggattaattgttatgacgtgtttggggctcag
gctccatttggaggttacaaagcttcaggtagcggcagagagctgggagagtacggcctg
gaggcctacaccgaggtcaaaacggtgatcatgagggttccacagaagaactcttag

DBGET integrated database retrieval system