KEGG   Cynoglossus semilaevis (tongue sole): 103388741
Entry
103388741         CDS       T04866                                 

Gene name
adcy3
Definition
(RefSeq) adenylate cyclase type 3
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem00230  Purine metabolism
csem01100  Metabolic pathways
csem04020  Calcium signaling pathway
csem04114  Oocyte meiosis
csem04261  Adrenergic signaling in cardiomyocytes
csem04270  Vascular smooth muscle contraction
csem04371  Apelin signaling pathway
csem04540  Gap junction
csem04912  GnRH signaling pathway
csem04914  Progesterone-mediated oocyte maturation
csem04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:csem00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    103388741 (adcy3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    103388741 (adcy3)
   04020 Calcium signaling pathway
    103388741 (adcy3)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    103388741 (adcy3)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    103388741 (adcy3)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    103388741 (adcy3)
   04914 Progesterone-mediated oocyte maturation
    103388741 (adcy3)
   04916 Melanogenesis
    103388741 (adcy3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103388741 (adcy3)
   04270 Vascular smooth muscle contraction
    103388741 (adcy3)
Enzymes [BR:csem01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     103388741 (adcy3)
SSDB
Motif
Pfam: Guanylate_cyc AC_N HNOBA fn3_4 OPA3 DUF1053
Other DBs
NCBI-GeneID: 103388741
NCBI-ProteinID: XP_008322097
LinkDB
Position
13
AA seq 1116 aa
MPRNRAFSEPEYSAEYSADCSVTLPSDPGQAVGRTHEVTVRSSGCCLCLPRFMRLTFTPE
SLENLYQTYFRRQRHETLLVLVVFAALFDSYIIVMCTVVFTSDKLATVLVASVGLAANII
LYLLCRFSVLPDRISRRVVPYALWVLIAAQIFCYLGLNYARFHQPSDTVGWQAFFSFSFF
LTLPLRLTPIVLISSVSCGVHTLVLGVTIAQQQQEDIQGAALGRQLLANIVIYVCAITVG
VMSYYMADRKHRKAFLEARQSLEVKLNLEEQSQQQERLLLSILPKHIADEMLQDMKKEPS
QKEMQQFNTMYMYRHENVSILFADIVGFTQLSSSCSAQELVKLLNELFARFDKLAAKYHQ
LRIKILGDCYYCICGLPDYREDHAACSIMMGLAMVEAISYVREKTQTDVDMRVGVHSGTV
LGGVLGQKRWQYDVWSTDVTVANKMEAGGIPGRVHISQSTMECLHGEFDVEPGNGGDRCD
YLKERGIETYLVVVPKGTVGNSCINGAKLSVTSSNGNSPLLINTTECNGSANTACTTPEE
PEELDTRVSRGRLRLRDLAERVIDAQENEQELNKLLNEALLERETVQALKGKHTNRLSLR
FVDPDLETRYSVEKEKQSGAAFCCSCVVLLFTAVMEVLIDPWLIANYITFAVGEVLLLIL
TICSLAAIFPRVFPKKLVSFSSWIDHTRWARNTWAMAAIFILTMADIMDMLSCLPRVSDP
GGATATPSSTSSSSTWSVPNGCMDNPKYYSYIAVLALMATTMLVQVSHMVKLTLMLLITA
ATGLVNIYSWRDIFDRYDMARFQDYRSYLVPSKFTMTIMIFIMMVSFYYFSRHVEKLART
LFLWKIEVHEQKEKVYEMRRWNEALVTNMLPEHVARHFLGSKKRDEELYSQSYDEIGVMF
ASIPNFSDFYTEESINNGGIECLRFLNEIISDFDSLLDEPQFRCITKIKTIGSTYMAASG
VTPDVSNGYACMKKEEQSDRERWQHLADLADFALAMKVTLMNINYQSFNNFMLRIGLNKG
GVLAGVIGARKPHYDIWGNTVNVASRMESTGVMGNIQVVEDCYNILKDYGFRFVRRGPIF
VKGKGELLTYFLKGRDKQGSFINGSSVTLPHQVVDS
NT seq 3351 nt   +upstreamnt  +downstreamnt
atgcctcgcaatcgagccttttctgaaccagaatactcagcggagtactcggctgactgc
tcagtgacgctgccctctgaccccgggcaggccgtgggacgaacacatgaagtcactgtt
cggagttcaggatgctgcctgtgtctgcccaggttcatgcgcctcacctttactcctgag
tctttggagaacctctatcagacctacttcagacggcagagacatgaaaccctgctggtg
ctggtcgtgttcgccgcactcttcgacagctacatcattgtcatgtgcacggtggtcttc
acatctgacaaactggccactgtgctggtggcttcagttggactggcagcaaatatcatt
ctgtacctactctgtcgcttcagcgtgctgccggaccgcatctccagacgggtggtgccc
tacgccctgtgggtgctcatagcagcccagatattttgttacctgggtttgaactacgct
cgcttccaccagcccagtgacacagtgggctggcaggctttcttcagcttctccttcttc
ttgactctgcctttgaggctgacgcccatcgtgctcatctcgtcagtgtcctgtggtgtc
cacactctggttctgggggtcaccattgcccagcaacaacaggaggacatccagggagca
gcacttggcagacagcttctggccaacattgtcatctatgtatgtgccattactgtgggc
gtcatgtcctactacatggccgaccgcaagcaccggaaggcatttctggaggccaggcag
tcactagaagtcaagctgaacctggaggagcagagtcagcaacaggaacgcctgctgctc
tccatcctcccaaagcacatagctgatgagatgcttcaggacatgaagaaggagcccagt
cagaaagagatgcagcagttcaacaccatgtacatgtacagacacgaaaatgtcagtatt
ctgtttgcagacatcgtgggcttcactcagctgtcatcgtcctgcagtgctcaggagctg
gtcaaactgctcaatgagcttttcgcacgttttgacaaactggctgctaaataccaccag
ttgaggatcaagatcttgggtgactgctactactgcatctgcgggctgccggactacaga
gaggaccacgctgcctgctccatcatgatgggcctggccatggtcgaggccatctcgtac
gtacgggagaaaacccagaccgatgttgacatgcgggtgggggtgcacagtggcacagtt
ctgggaggtgtccttggccagaaacgatggcagtatgacgtctggtccacagatgtcaca
gtggccaataaaatggaggctggggggataccaggtcgtgtccacatctcacagagcacc
atggagtgtcttcacggggagtttgatgtggagccagggaacggaggtgaccgctgtgac
tacctgaaggaaagaggcatcgagacttacctggtggtcgttcctaaaggaacagtggga
aatagttgcatcaatggcgcaaaactctctgttacctcttccaatggaaactccccgctg
ttaatcaacaccaccgagtgtaatggcagtgctaacacagcctgcaccacaccagaggaa
ccagaagaactagatacgagggtaagcagggggaggctacggctgcgggacctggctgag
agggtgattgatgctcaggagaacgagcaggaactcaacaaactgctcaacgaggcactg
ctggagagagagacagtccaggctttgaagggaaaacacacaaaccgcctctcgctgagg
tttgtggatccagacctggagactcgttactctgtggagaaagagaagcagagcggcgct
gccttctgctgctcctgtgtcgttctgctcttcaccgcagtcatggaggtgctcatagac
ccctggctgattgcaaattacatcacctttgcggtgggagaagtcctgctgctcatcctg
acaatctgctctctggctgccatcttcccccgggtctttcccaaaaagttggtgtcgttc
tcctcttggatcgatcacacacgctgggctcgtaacacctgggccatggcagcgatcttc
atcctcaccatggccgacatcatggacatgttgagttgtttgcctcgggtttctgacccg
ggcggtgctacagcgactccatcctccacctcctcgtcctccacctggtctgtccctaat
ggctgcatggacaaccccaaatattacagctacatagctgtgctggctcttatggcaacc
actatgctggtccaggtcagtcacatggtcaagctcacactgatgcttctcatcactgcg
gccaccggcctggtaaacatctacagctggcgagacatctttgaccgctacgacatggcc
cgttttcaggactacaggtcataccttgtcccctcaaagttcactatgaccattatgatc
ttcataatgatggtcagcttctattatttttcccgacatgtggagaaactcgcccgcacg
ttgttcctgtggaagattgaagtccatgagcaaaaagagaaagtttacgagatgagacgc
tggaatgaagccctggtgaccaacatgctgcctgaacatgtggctcgccacttcctgggc
tcgaagaaaagggatgaggagttgtacagtcagtcctatgatgagattggagtcatgttc
gcctccatccccaacttctctgacttctacacagaagagagcattaataatggagggatc
gaatgtttacgcttccttaatgagatcatctctgactttgacagtctgcttgatgaacca
cagtttcgctgtataacaaaaataaagaccattggcagcacctacatggcagcgtcaggc
gtcaccccagatgtcagtaatggctatgcgtgcatgaagaaagaagagcagtctgacaga
gagcgctggcagcacctagcagacctggcagactttgctctggccatgaaggtcacactc
atgaatataaattaccagtcgttcaacaacttcatgctacgcattggactcaacaaaggt
ggagtgttagcaggagtaatcggggcacgtaaacctcactacgatatatggggcaacact
gtgaacgtggccagtcgcatggagtccacaggggtgatgggtaacatccaggtggtggag
gactgctataacatcctaaaggactatggcttccgctttgtaaggaggggccccattttt
gttaagggaaaaggagagttgctgacttattttttgaagggaagagacaaacaaggctcc
tttatcaacggctcctccgtcactctgccacaccaggtggtggacagctaa

DBGET integrated database retrieval system