KEGG   Cynoglossus semilaevis (tongue sole): 103388781Help
Entry
103388781         CDS       T04866                                 

Gene name
sdha
Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial isoform X1
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem00020  Citrate cycle (TCA cycle)
csem00190  Oxidative phosphorylation
csem01100  Metabolic pathways
csem01200  Carbon metabolism
Module
csem_M00009  Citrate cycle (TCA cycle, Krebs cycle)
csem_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
csem_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:csem00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    103388781 (sdha)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    103388781 (sdha)
Enzymes [BR:csem01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     103388781 (sdha)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA FAD_binding_3 DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 103388781
NCBI-ProteinID: XP_008322167
LinkDB All DBs
Position
13
AA seq 663 aa AA seqDB search
MAGVCAASRLFSKTVLSKTKAVPAAAVQGCRNFHFSIYGKKNNAKVSDNISTQYPVVDHE
FDAVVVGAGGAGLRAAFGLSEAGFNTACVTKLFPTRSHTVAAQGGINAALGNMEEDDWRW
HFYDTVKGSDWLGDQDAIHYMTEQAPAAVVELENFGMPFSRTEDGRIYQRAFGGQSLKYG
KGGQAHRCCCVADRTGHSLLHTLYGRSLRYDTSYFVEYFALDLLMEDGECKGVIALCMED
GSIHRFRANNTVIATGGYGRTYFSCTSAHTSTGDGNAMVTRAGLPCQDLEFVQFHPTGIY
GAGCLITEGCRGEGGILINSEGERFMERYAPNAKDLASRDVVSRSMTIEIREGRGVGPEK
DHVYLQLHHLPPQQLASRLPGISETAMIFAGVDVTKEPIPVLPTVHYNMGGIPTNYRGQV
ITHTNGEDTVVPGLYACGEAACASVHGANRLGANSLLDLVVFGRACALTIAEVHKPGEKL
SALKPSAGEESVANLDKMRFANGSMRTSEIRLNMQKTMQAHAAVFRTGSVLKEGCDKMDG
IYQTMDDIKTFDRGIVWNTDLVETLELQNLMLNAVQTIHSAEQRKESRGAHAREDFKERV
DEYDYSKPLQGQEKKPFDQHWRKHTMSYVDPKTGKVTLEYRPVIDHSLDEQDCAHVPPAI
RSY
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atggcgggtgtttgtgctgcctctcggctcttctccaagacggtactgtctaaaactaaa
gcggtcccagctgctgcagtacagggctgtcgaaactttcacttctccatctatggcaaa
aagaacaatgccaaagtatcagacaatatctccacccagtatccagttgtggatcatgag
tttgatgctgtggtggttggagctggaggagcaggactgagagcagcctttggtctgtca
gaggctggattcaacactgcatgtgtgactaaacttttccccaccagatcccacacagtg
gctgcacagggtggaatcaatgcagctcttggaaacatggaggaagatgactggaggtgg
catttctacgacacagttaaaggttctgattggctgggagaccaggatgctattcactac
atgacagaacaggctcctgcagctgtagtagagttggagaactttggcatgccgtttagt
cgcactgaggatggaaggatctatcagagagcttttggaggtcagagtctgaagtatgga
aaaggtggtcaggctcatcgatgctgctgtgtggctgacaggaccggtcactcactgctg
catacactttatggacgatcactgcgatatgacaccagctactttgtggagtactttgcc
ttggacctgctcatggaagatggagaatgtaaaggagtaattgctctttgcatggaggat
ggatctattcatcgattcagggcaaacaatactgtcattgctactggtggttatggaagg
acctacttcagctgtacatcagcccacacaagcacaggagatggaaatgcaatggtgacc
agagccggtctgccctgccaggatctggagtttgtacagttccatcctactggaatttat
ggagctggttgcctgatcacagagggttgtcgtggtgaaggtggaatcctcatcaacagt
gagggagaacgcttcatggagcgttacgctccaaatgctaaagatcttgcctccagggac
gttgtgtctcgctcgatgaccatagagatccgagagggacggggtgttggtccagagaaa
gaccacgtgtacctgcagcttcaccacctgcctcctcagcagctggcctccaggctgcct
ggtatctctgagactgccatgatttttgctggagtggacgtcaccaaagagcccattcct
gtgttgcctacagttcattacaatatgggtgggatccctacaaactacaggggtcaagtg
atcacacacaccaatggagaggacacagttgttcctggactttacgcctgcggtgaggcg
gcatgtgccagtgtgcacggtgctaaccgacttggtgccaactccttgctggatctggtg
gtgtttggaagagcctgtgccctgaccattgcagaggtgcacaaacctggggagaaactc
tctgcactcaagcccagtgcaggagaagagtctgtggccaaccttgataaaatgaggttt
gccaatggatccatgagaacctctgagatcaggctcaacatgcagaagaccatgcaggct
catgctgctgtgttccgtactggttctgtgctaaaagagggatgtgacaaaatggatggc
atctaccagaccatggatgatatcaaaacctttgaccgaggcattgtgtggaacacagac
ctggtagaaaccctggagctccagaacctgatgctgaacgcagtccagaccattcactct
gctgagcagagaaaggaaagcagaggagcccatgccagagaggactttaaggagcgtgtg
gatgagtatgactactccaagcctctgcagggtcaagagaaaaagccttttgaccagcac
tggaggaaacacaccatgtcctacgttgaccctaaaactggcaaggtgactttggagtac
cgtcctgttattgaccactctttggacgagcaggactgcgctcatgttcctcctgccatc
agatcttactaa

DBGET integrated database retrieval system