KEGG   Cynoglossus semilaevis (tongue sole): 103389000Help
Entry
103389000         CDS       T04866                                 

Definition
(RefSeq) trypsin-1
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:csem00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    103389000
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:csem01002]
    103389000
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:csem04147]
    103389000
Enzymes [BR:csem01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     103389000
Peptidases [BR:csem01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   103389000
Exosome [BR:csem04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   103389000
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin DUF1986 Trypsin_2
Motif
Other DBs
NCBI-GeneID: 103389000
NCBI-ProteinID: XP_008322474
LinkDB All DBs
Position
13
AA seq 242 aa AA seqDB search
MRSLVFVLLIGAAFALEDDKIVGGYECQPYSQPHQVSLNSGYHFCGGSLVNENWVVSAAH
CYKSRVEVRMGEHNIKVTEGTEQFISSSRVIRHPNYSSYNINNDIMLIKLSKPATLNQYV
KPVALPSSCAPAGTMCKVSGWGNTMSSTADKNKLQCLDLPILSDSDCRNSYPGMITNAMF
CAGYLEGGKDSCQGDSGGPVVCNGELQGVVSWGYGCAEKDHPGVYAKVCLFNDWLERTMA
SY
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgaggtctctggtctttgttctgctcatcggagctgcttttgccttggaggacgacaag
atcgttggagggtatgagtgtcagccatactcccagccccatcaggtgtctctgaactcc
ggctaccacttctgtggaggctctctggtcaatgagaactgggtcgtgtctgctgctcac
tgctacaaatcccgtgtggaggtgcgtatgggcgagcacaacatcaaggtcactgagggt
actgagcagttcatcagctcctcccgtgtcatccgtcaccccaactacagctcctacaac
atcaacaacgacatcatgctcatcaaactgagcaagcctgccactctcaaccagtatgtg
aagcctgtggctctcccctccagctgtgcccctgctggcaccatgtgcaaagtctctggc
tggggcaacaccatgagctctactgctgacaaaaacaagctgcagtgcttggacctccct
attctgtctgacagtgactgcaggaactcctaccctggaatgatcaccaatgccatgttc
tgtgctggatacctggagggtggcaaggactcttgccagggtgactctggtggccccgtt
gtgtgcaacggcgagctgcagggtgttgtgtcctggggatacggatgtgctgagaaggat
caccctggtgtctacgccaaggtctgtctcttcaacgactggctggagaggaccatggcc
agctattaa

DBGET integrated database retrieval system