KEGG   Cynoglossus semilaevis (tongue sole): 103389070Help
Entry
103389070         CDS       T04866                                 

Gene name
cercam
Definition
(RefSeq) probable inactive glycosyltransferase 25 family member 3
  KO
K11703  collagen beta-1,O-galactosyltransferase [EC:2.4.1.50]
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem00310  Lysine degradation
csem00514  Other types of O-glycan biosynthesis
csem01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csem00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    103389070 (cercam)
  09107 Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    103389070 (cercam)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:csem01003]
    103389070 (cercam)
Enzymes [BR:csem01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.50  procollagen galactosyltransferase
     103389070 (cercam)
Glycosyltransferases [BR:csem01003]
 O-Glycan biosynthesis
  O-linked Gal type
   103389070 (cercam)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_25 Glyco_tranf_2_4
Motif
Other DBs
NCBI-GeneID: 103389070
NCBI-ProteinID: XP_016893913
LinkDB All DBs
Position
14
AA seq 509 aa AA seqDB search
MLKEWLTVMQKYYHYVEWRPMDMPVSYVGELGPKHWPNSRYQRVMKLKQAALDFARKRWA
DYILYADTDNILTNPDTLNLIMGENKSVIAPMLDSQGAYSNYWCGITPQGYYRRTAEYFP
TRHRHRLGCFPVPMVHSTMLLDLRKEGMKKLAFFPPHEEYSWPYDDIIVFAFSCRAAGIQ
MYLCNKERYGYLNVPSKPYDTLEDDRLNFVHVHLESMIDGPPMLVSQYVHMFPKQRDLMG
FDEIYLINLRRRPDRRDRMLFSLNELEIDVKVVDAVDGNALNSSEIKILGVDLLPGYYDP
FSGRTLTKGEVGCFLSHYFIWKEMVDEQMDKALVLEDDIRFQANFKRRALRLMEEVEQVE
LDWDIIYFGRKQVNPTKEEEVENVHNLVWAGYSYWTLSYAISLQGAQKLLNAEPLSKMLP
VDEFLPIMYDKHPNEDYKSHFPNKNLQAFSTRPLLVQPCHYAGDPEWISDTETSTLWDND
TVRTDWRGSHKTLKGSAPEMLSVAYKDEL
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgctgaaggagtggctcacagtcatgcagaaatattaccattacgtggagtggagaccg
atggacatgccagtatcctatgtaggagaactgggtcccaaacactggcctaacagcaga
tatcaacgcgtgatgaagctgaagcaggcagcactggactttgccaggaaacgctgggct
gactacatcctgtacgctgacactgacaacatcctcaccaacccagacacactcaacctg
ataatgggagaaaacaagtcggtgatcgctcccatgttggactctcagggagcctactcc
aattactggtgtggtatcactccacagggatactaccgtcgaacagcagagtacttccct
acccgtcaccgtcacagactgggctgctttcctgtacccatggtccactccaccatgttg
ctggacctgaggaaggagggtatgaagaagctggccttcttccctcctcatgaggaatac
tcctggccatacgacgacatcattgtgttcgctttctcctgtcgagctgcagggatacag
atgtatttgtgtaacaaggagcggtacggttatctaaacgtgccgtccaaaccttacgac
accctggaggatgatcgtcttaactttgtccatgtccatctggaatcgatgattgatggc
cctcccatgcttgtgtctcaatatgtccacatgttcccaaaacagagggaccttatgggc
tttgatgagatatatctaataaatctacgtcgccgtcctgaccgaagagacagaatgttg
ttttctctgaatgagctggagattgacgtgaaggtggtggatgcagtggatggaaatgca
ctgaacagcagtgagatcaaaatcctgggtgttgacctgctaccagggtactatgacccc
ttctcaggacgcactctgactaaaggagaggtgggctgcttcctcagccactacttcatc
tggaaggagatggttgacgagcagatggataaagcccttgtcttggaagacgacatccgt
ttccaggcaaacttcaaacgacgagccctcaggctgatggaggaggtggagcaggtggag
ctggactgggacattatatactttgggaggaagcaggttaatcctacaaaggaggaggaa
gtggaaaatgtccataatttggtgtgggcgggttattcctactggactctgtcttatgcc
atctccttacaaggagcccagaaactgctgaatgctgaaccactgtccaagatgctgcct
gtggacgaattcctccccatcatgtatgacaaacatcccaatgaggattacaaatcccac
ttccccaacaaaaacctgcaggccttcagcacacgccccctgctggttcagccatgtcat
tacgctggtgatcctgagtggataagcgacacagagacatcaacgctgtgggacaacgac
acagtacgcacagactggagaggttcccacaagaccttgaaaggatctgcaccagagatg
ctctcagtggcctacaaggatgaactttag

DBGET integrated database retrieval system