KEGG   Cynoglossus semilaevis (tongue sole): 103389255Help
Entry
103389255         CDS       T04866                                 

Definition
(RefSeq) procollagen-lysine,2-oxoglutarate 5-dioxygenase 3-like
  KO
K13646  lysyl hydroxylase/galactosyltransferase/glucosyltransferase [EC:1.14.11.4 2.4.1.50 2.4.1.66]
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem00310  Lysine degradation
csem00514  Other types of O-glycan biosynthesis
csem01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csem00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    103389255
  09107 Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    103389255
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:csem01003]
    103389255
Enzymes [BR:csem01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.4  procollagen-lysine 5-dioxygenase
     103389255
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.50  procollagen galactosyltransferase
     103389255
    2.4.1.66  procollagen glucosyltransferase
     103389255
Glycosyltransferases [BR:csem01003]
 O-Glycan biosynthesis
  O-linked Gal type
   103389255
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Anp1 2OG-FeII_Oxy_3
Motif
Other DBs
NCBI-GeneID: 103389255
NCBI-ProteinID: XP_008322817
UniProt: A0A3P8UY62
LinkDB All DBs
Position
1
AA seq 735 aa AA seqDB search
MSTMCYRLFCLVVFVIDYSSVSAEQRKLSPENLLVITAATEATDGFNRFMRTAKEFNYTV
KVLGLGEDWKGGDVARTVGGGQKVRWLKKELLKHSEKEDMVIMFVDSYDVIFASGPEELL
FKFSRLGHRVVFSAEGFCWPDQRLAPKYPVVHTGKRYLNSGGFIGMAPDLSAIVQQWKFK
DNDDDQLFYTKIYLDKTQRTKFNMTLDHRSRIFQNLNGAVDEVVLKFERAKVRVRNVAYD
TLPVVIHGNGPTKLQLNYLGNYVPTAWTYENGCGHCDDDLLFFNDVEDEEMPLVYVAVFI
ERATPFMEEFLERLTTLNYPLTRIRLFIHNNVVYHERHIQKFWEHHRYLFPDALIVGPEE
NLKEDKARTMAVEACKKDPECDYYFSIDSDVAVTNPDILRILMEENKSVIAPTLSKHGKL
WSNFWGALNPEGYYSRSEDYIEIAQVTRIGVWNVPYITQVYLIKGSILRSKLSLVRLFES
EGMDSDMVFCKSIRDQGVFMYVSNREEFGRLVASNNFNTSRLHPDMWQIFDNPVDWKEKY
INENYSKIFEDQKSFVEQPCPDVYWFPTFSEKMCDHLVETMEDNGGWSGGTHKDERLAGG
YENVPTVDIHMNQIEFEKEWLKFLKEYISPVTEKLYPGYYPKAQAIMNFVVRYRPDEQPS
LRPHHDSSTFTVNIALNNKNIDYEGGGCRFLRYDCKVESPRKGWSFMHPGRLTHYHEGLP
TTRGTRYIMVSFVDP
NT seq 2208 nt NT seq  +upstreamnt  +downstreamnt
atgtccaccatgtgttatcgtcttttctgcctggtggttttcgtcatcgactacagctcc
gtgtccgccgaacagcgaaagcttagtccagaaaacttgctggtgatcactgcggcaacg
gaggctacagatggtttcaaccgtttcatgagaacagcgaaggagttcaactacactgtc
aaggtgctgggtctgggggaggattggaaaggtggtgacgtggctcggacggtgggtgga
ggtcagaaggtcagatggttaaaaaaggagctgctcaaacactcagaaaaggaggacatg
gtcatcatgtttgtggacagctatgatgtcatctttgcttctggtccagaggagcttctc
tttaagttttcccgtctaggtcacagagtggtcttctcagcggaaggattctgctggccc
gaccagagactggcccccaaatatccagtggtgcacactgggaaacgctacctcaactct
ggaggtttcattggcatggctccagacctgagtgccatcgttcagcagtggaagttcaag
gacaatgacgacgaccagcttttctacaccaagatctacctggacaagacacagaggaca
aagtttaacatgactctggatcatcgctcgagaatcttccagaatctgaacggagctgtt
gatgaagtggtcctgaagtttgagagggcaaaggtcagagtgaggaacgttgcctacgac
acacttcctgtcgttatccacgggaatgggcccacaaagctgcagctcaactatctgggg
aactacgtgccgacagcctggacctatgagaacggctgtggacactgtgacgatgatctg
ctcttcttcaacgacgtagaggacgaggagatgcccctggtctacgtggctgtcttcatc
gaacgtgccacacccttcatggaggagtttctggagagactgaccacgctcaattacccc
ttgaccaggatccgcctcttcatccacaacaatgtggtgtaccatgaacgtcacatccag
aagttctgggagcatcacaggtatctgttccctgacgctctgatagtgggaccagaggaa
aacctaaaggaggacaaggcccgaaccatggctgtagaggcgtgtaagaaggatccagag
tgtgattattacttcagcattgactctgacgtggctgtcacaaaccctgacatcctgagg
attctgatggaggagaacaagtccgtcattgctcccacattatccaaacatggaaaactg
tggagtaacttctggggagccttgaaccctgaagggtactactccagatctgaggactat
attgagattgcccaggtaacgagaattggtgtgtggaatgtgccgtacatcactcaggtc
tatctgatcaaaggcagcatccttcggtccaaactgtccctggtccgactgtttgagagc
gagggcatggattctgacatggttttctgcaagagcatcagagatcagggcgtcttcatg
tacgtgtccaaccgtgaagagtttggtcgcctggtggcatccaataacttcaacacatcc
aggctgcacccagacatgtggcagatctttgacaaccctgtggactggaaggaaaagtat
atcaacgagaactactccaagatttttgaagaccagaagagctttgtggagcagccttgt
ccagatgtttactggttcccaaccttctcagagaagatgtgcgatcacctggtggagacc
atggaggacaatggagggtggtctggaggaacccacaaggatgaacgtctggctggtgga
tacgagaacgttccaactgtggacatccacatgaaccagattgaatttgaaaaggagtgg
ttgaagttcctgaaagagtacatttctcccgtcaccgagaaactctaccctggatattac
ccaaaggcacaagccatcatgaactttgttgtgcgctatcgtcctgatgagcagccctcc
ctgcggccacatcatgactcttcgacgttcaccgtcaacatcgctctcaacaataagaac
atcgactatgagggaggtggctgcagattcctgcgctacgactgcaaggtggagtccccc
agaaaaggctggtccttcatgcacccgggtcgcctcacacactaccatgaaggcctgccc
accaccagggggacccgttatatcatggtatcgtttgttgacccctga

DBGET integrated database retrieval system