KEGG   Cynoglossus semilaevis (tongue sole): 103389529Help
Entry
103389529         CDS       T04866                                 

Gene name
hdac4
Definition
(RefSeq) histone deacetylase 4 isoform X2
  KO
K11406  histone deacetylase 4/5 [EC:3.5.1.98]
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:csem00001]
 Environmental Information Processing
  Signal transduction
   04371 Apelin signaling pathway
    103389529 (hdac4)
Enzymes [BR:csem01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     103389529 (hdac4)
Chromosome and associated proteins [BR:csem03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     103389529 (hdac4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl HDAC4_Gln
Motif
Other DBs
NCBI-GeneID: 103389529
NCBI-ProteinID: XP_008323193
LinkDB All DBs
Position
14
AA seq 1113 aa AA seqDB search
MLNAPLAMTSHSHQEGILGKEQPLEVLKTSALNHIPTVDINSALPLRLPPAAIPMDLRVD
HHHHQQQQQQQQLSSLSPPGQQSPGGLGGPGQPGGGGGVVVASVREQQLQQELLTLKQKQ
QIQRQLLIAEFQRQHEQLSRQHEVQLQEHITQQQELLALKHQQELLEHQRKMENHRLEQE
LEKQQREQKLQLLKNKERGQESAVASTEVKMRLQEFVLNKKKALAQRSLNQGGLPNDAPY
WYRKTQHSSLDQSSPPQTGMSAYNHPVLGVYNPRDDFPLRKTASEPNLKLRSRLKQKVSE
RRSSPLLRRRDSPITTAKKRSLDLADSACNSAPGSGPSSPNNSSNNIPKENGIAVSVANS
TEASLAQRLSSGAERSSVNQLSLYPSPSLPNITLGLPATATATAASNVTSAQQDGGLQPA
LSLSPPFLSGAHLTPYLPEAGAGTGGHGAHSPLLQHMVLIEQSPAQSPLVTGVSGLSMSS
AASMAKLQRQHRPLGRTQSAPLPQGSAAQAHAQALALQQLVVQQQHQQFLEKHKQQFQQQ
QLHLNKMMAKPSESPVGRQHQSHPEETEEELREHQDPGALPPGVTIKQEPLDPQEMQEEA
MQQQQQQQHRERQAEQELLFRQQAFLLEQQRIHQLRNYQASMEAAGLSISFPGHRPLSRA
QSSPASASSFPISVPAPEPSVKPRFTTGLVYDSLMQKHQCMCGNTNSHPEHAGRIQSIWS
RLQETGLRAQCECIRGRKATLEELQTVHSEAHVLLYGTNPLRQKLDCSITPMFVRLPCGG
IGVDSDTIWNEVHSSSAARLAVGSVVELVFKVATGELKNGFAVVRPPGHHAEESTPMGFC
YFNSVAIAAKLLQQRLSINRILIVDWDVHHGNGTQQAFYDDPNVLYLSIHRYDDGNFFPG
SGAPDEVGSGAGVGFNVNVAFTGGLDPPMGDTEYLAAFRSVVMPIANEFAPDIVLVSSGF
DAVEGHPPPLGGYTLTSKCFGHLTRQLMTLAGGRVVLALEGGHDLTAICDASETCVAALL
GQELDPLPKAVLEQRPNANAVRSLEKVLETHSKYWRCVHRSSSRLGLSLLEAKQGDSEEA
EAVSAMASLSVANSSAIEHSRQEEEPMEEEEPL
NT seq 3342 nt NT seq  +upstreamnt  +downstreamnt
atgttgaatgcaccactggcgatgacgtcacacagccaccaagaagggatcctggggaag
gagcagccactggaggttctaaagacatctgcgctcaaccacatcccaacagtggacatt
aactcagctttgccgctgcgtctcccgcccgctgccatccccatggacctacgtgtagac
caccaccaccaccagcagcagcagcagcagcagcagttgtcatcgctctccccgcctggt
cagcagtcacccgggggtctcgggggcccgggtcagcccggtggcggcgggggtgtagtg
gtggcctctgtccgggagcagcagctacagcaggagctgctgaccttgaagcagaagcag
cagatccagagacagctccttatcgcagagttccagaggcagcacgagcagctgtcccgc
cagcatgaggtgcagctgcaggaacacattacgcagcaacaggagctgctggcgttaaaa
caccaacaggagctgctggagcaccagaggaagatggagaaccatcgtctggagcaggag
ctggagaagcagcagagggagcagaagctgcagctgctgaagaacaaggagaggggacag
gaaagtgcagtggccagtactgaagtcaagatgcgtcttcaggagtttgtcctaaacaag
aagaaagccctggctcaacggagccttaaccagggtggtctgcccaacgatgccccctac
tggtaccggaaaacccagcacagttctctggaccagagctcgcccccacaaaccggcatg
tctgcctacaaccaccctgtgctgggtgtttataacccaagggacgacttcccactgaga
aaaactgcttcggaacccaacctgaagctgcgctcacggctgaagcagaaggtcagcgag
aggaggagcagcccactgctgcgacgccgagacagccccatcaccaccgccaagaaacgc
tccctggacctggcagactcggcgtgtaacagcgccccgggctcaggaccaagctctcca
aacaacagctccaacaacatccccaaagaaaacggcatcgcagtgtcagtggccaacagc
acagaggcgtctctggcccagaggctgagcagtggtgctgagcgcagctccgttaaccag
ctgtccctctacccttcgccatccttacccaacatcaccctggggctgccagccactgcc
acggccaccgctgcttcaaacgtgacctcggcccagcaggatggaggcctgcagcccgca
ctttctctcagccctcctttcctctctggggctcacttgaccccatacttacctgaagca
ggagcaggaacaggcggacacggagctcatagtccattactgcagcacatggtccttata
gagcagagccctgcacagagccccctggtgacaggtgtcagtggtctgtccatgtcctcg
gccgcatccatggccaagctgcagcggcagcacaggccactgggtaggacccagtcggcg
cctctgcctcaggggagcgctgcccaggctcatgcccaggccctggccctgcagcagctg
gtggtccagcagcagcatcagcagttcctggagaagcacaagcagcagttccagcagcag
cagctgcacctcaacaagatgatggcaaaacccagtgagtcacctgtgggtcgtcagcac
cagagccacccggaggagacagaggaggagctgagggagcaccaagaccctggagctcta
ccaccgggtgtcaccatcaagcaggagccactcgacccgcaggagatgcaggaggaggcg
atgcagcagcagcagcagcagcagcacagggagcggcaggcggagcaggagctgctgttc
agacagcaggctttcctgttggagcagcagaggattcaccagctgaggaactaccaggcc
tccatggaggccgcgggcctgtccatatcgttccccggacaccgtcccctgtccagagct
cagtcctctccggcctcagcatcctcttttcccattagcgtgccggcccctgaaccttcg
gtcaaacctcgattcaccacaggtctggtgtacgactctttgatgcagaaacatcagtgc
atgtgtggaaacaccaacagtcacccggagcacgccgggaggatccagagcatctggtca
cggctgcaggagaccggactcagagcccagtgtgagtgtatccgagggagaaaagccact
ctggaggagctgcagactgttcactctgaagcccacgtcctgctgtatggaaccaaccct
ctccgacagaaacttgattgttcaattactccaatgtttgtaaggttaccgtgtggtgga
attggggtggacagtgacaccatttggaatgaagtccactcctccagtgcggcccgtctc
gctgtgggctctgtcgtggagcttgttttcaaagtggccacaggagagctgaagaatgga
tttgctgtggttcgtcctccgggacatcatgcagaggagagcacgcccatggggttctgt
tacttcaactctgtggccatcgctgccaaactgttgcagcagagactcagcatcaacagg
atcctcatcgtggactgggacgttcaccatggtaacggtacccagcaagccttttatgat
gacccgaatgtcctctatctgtctattcaccgctatgatgatggtaacttctttcctgga
agcggtgctcctgatgaggtgggcagtggagcaggggtcggcttcaacgtcaacgttgcc
tttaccggaggtctggacccaccgatgggagacacggagtatctagcagccttcaggtca
gtggtgatgcccatagccaatgagttcgctccagacatcgttctggtctcctcaggcttt
gacgctgtcgagggacatcctccgccactaggaggctacactctgacgtccaaatgtttc
ggacatctgacaaggcagctcatgaccctggctggaggtcgtgtagtgctggctctggag
ggaggtcacgacctcactgccatttgcgacgcctcggagacctgtgtagccgccctgctc
ggccaagagctggatccactgcccaaggccgtcctggagcagaggcccaatgccaacgcc
gtccgctccctggagaaggttctagagactcacagtaaatactggcgctgcgtgcaccgc
agctcctcacgactggggctgtcactgctggaggccaaacagggagactcggaggaggcg
gaggccgtgagcgccatggcctctctgtccgtggccaacagcagcgccatcgaacacagc
agacaggaggaggagccaatggaggaggaggagccactgtaa

DBGET integrated database retrieval system