KEGG   Cynoglossus semilaevis (tongue sole): 103389593Help
Entry
103389593         CDS       T04866                                 

Gene name
gpd2
Definition
(RefSeq) glycerol-3-phosphate dehydrogenase, mitochondrial isoform X1
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:csem00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    103389593 (gpd2)
Enzymes [BR:csem01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     103389593 (gpd2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAO DAO_C EF-hand_7 EF-hand_1 FAD_binding_2 EF-hand_6 FAD_oxidored EF-hand_8 Pyr_redox_2 GIDA Pyr_redox_3 Thi4 EF-hand_5 NAD_binding_8 EF-hand_4 EF-hand_9 HI0933_like SPARC_Ca_bdg
Motif
Other DBs
NCBI-GeneID: 103389593
NCBI-ProteinID: XP_008323275
UniProt: A0A3P8V8T4
LinkDB All DBs
Position
14
AA seq 730 aa AA seqDB search
MAFRKALKHTVLIGGGAAATFLGLSQLIEYKKTQPGLARLAHVTAEAELKVPFADELPSR
QAQLRTLKSTEEFDVLIVGGGATGAGCALDAVTRNLKTALVERSDFSSGTSSRSTKLIHG
GVRYLQKAIMQLDYEQYKMVKEALHERANLLEIAPHLSAPLPIMLPVYKWWQLPYYWAGI
KMYDLVAGIHCLKSSYVLSKTKALELFPMLKKDRLVGAIVYYDGQHNDARMNLAIALTAA
RYGACLTNYTEVVNLLKTTDPQTGKEKVCGARCRDTITGEEFDVKAKCVINATGPFTDSL
RKMDNQETRNICQPSAGVHIVIPGYYSPDNMGLLDPATSDGRVIFFLPWEKMTVAGTTDS
PTSVTAHPIPGEDDINFILREVRNYLSPDVEVRRGDVLAAWSGIRPLVTDPNSKDTQSIC
RNHIVSISDGGLVTIAGGKWTTYRSMAEETLDAAIKAHNLPAESCKSIGLMLEGAKGWTP
TLYIRLVQDYGLEMEVAQHLASTYGGRAFEVAKMAQVTGQRWPIVGKRLVSEFPYIESEV
LYAIKEYACTATDVIARRTRLGFLNVQAADEALPRIVQIMGKELGWSQEKKTAELEAAKK
FLYHEMGYRSRSEQLTKTSDINLDNQEVARYKKRFHKFDKESKGFITTVDVQQVLESINV
NIDENALHEILNEVDLNKNGQVEIDEFLQLMSAVKKGQVSGSRLAILMKTAEETLEKRGP
VTVDRSGGGV
NT seq 2193 nt NT seq  +upstreamnt  +downstreamnt
atggcgttcaggaaggcactgaagcacaccgtgctcatagggggtggggcagccgccacg
tttttgggcctctcacagttgatcgagtacaagaaaacacagcctggattggcccgacta
gcccatgtgacagcagaagctgagctgaaggttccctttgcggacgaactccccagccga
caggcccagctcaggacgctaaaaagcactgaggagtttgatgtcctgattgttggagga
ggtgcaacaggggcaggatgtgccttagacgcggtcacacgcaacctcaaaactgccctg
gtagagagaagcgatttctcttctgggaccagcagccgcagcaccaagctgatccacggt
ggagtacgttatcttcagaaggctatcatgcagctggactatgagcagtacaagatggtc
aaagaggccctccatgagagagccaacctcttggagatcgcacctcacctgtctgcacca
cttccaatcatgttgcctgtttacaaatggtggcagttaccctactactgggcagggatc
aagatgtatgacttagtggctggaatacactgtttgaaaagcagctatgtcctcagtaag
accaaagctttggagctgttcccaatgctgaagaaggacagactggtgggagcaattgtc
tactacgatggtcaacacaatgatgcccgtatgaacctggctatcgccctgactgctgct
cgctatggtgcctgcctcactaactacactgaggtcgttaacctgttaaagacaacagac
ccacagactggcaaagagaaagtgtgtggtgcccgctgcagggacaccatcacaggagag
gagtttgatgtcaaggccaaatgtgtgatcaacgccactggaccattcacagactcactg
aggaagatggacaaccaggaaaccagaaacatctgtcagcccagtgcaggtgttcacatc
gtcattcctggttactacagtcctgacaacatgggtctgctggatccagccacaagtgac
ggacgtgtcatattcttcctgccctgggagaagatgactgtcgccggaacgactgacagt
cccactagtgtgacagctcatccaattcctggcgaggacgacatcaacttcattctgaga
gaagtccgcaactacctcagccctgatgtagaagtgcgtcgaggtgatgtgctcgcagcc
tggagcggcatccgcccactggtgactgatcccaactctaaggacactcagtccatctgc
aggaaccacatcgtcagcatcagtgacggtggactggtcactattgctggtgggaagtgg
accacatacaggtctatggctgaagaaactctggacgcagccatcaaagcccacaatctg
ccagcagagtcctgcaagtctattggtctgatgctggagggggccaagggatggacaccg
accctctacatccgtctagtgcaggactatggtctggagatggaggtagctcagcacttg
gcttccacctatggtggaagagcatttgaagtggcaaagatggctcaggtcacgggacaa
agatggccgatcgtggggaaacgactggtgtcagagtttccttacatagaaagtgaggtt
ctgtatgcaatcaaggaatatgcctgcaccgccactgatgtcattgctcgcaggacacgt
ctgggctttttgaatgtgcaggcagcagatgaagctctgccccgcatcgtccagatcatg
gggaaggagcttggctggagtcaggaaaagaagacggcagaacttgaagctgctaagaag
tttttgtaccatgagatgggctacaggtctcgttctgagcagctgactaaaacatctgac
atcaacttagacaaccaggaggtcgccagatacaagaagcggttccacaaatttgacaag
gagagcaaaggattcatcaccaccgtcgacgttcaacaggttttggagagcatcaatgtc
aacattgatgaaaatgcactccatgagatccttaatgaagtggacctcaataagaatgga
caagtagaaatagatgaattcctgcagctgatgagcgcagttaaaaagggccaagtgtca
ggcagtcgtctggccatcctgatgaagacagcagaggagactctggaaaagagggggcca
gtgacggtggaccgcagcggaggtggcgtgtga

DBGET integrated database retrieval system