KEGG   Cynoglossus semilaevis (tongue sole): 103389766Help
Entry
103389766         CDS       T04866                                 

Gene name
lig4
Definition
(RefSeq) DNA ligase 4 isoform X2
  KO
K10777  DNA ligase 4 [EC:6.5.1.1]
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:csem00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    103389766 (lig4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:csem03400]
    103389766 (lig4)
Enzymes [BR:csem01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     103389766 (lig4)
DNA repair and recombination proteins [BR:csem03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    DNA Ligase 4 complex
     103389766 (lig4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C DNA_ligase_IV BRCT_2 RNA_ligase BRCT mRNA_cap_enzyme
Motif
Other DBs
NCBI-GeneID: 103389766
NCBI-ProteinID: XP_008323547
LinkDB All DBs
Position
14
AA seq 910 aa AA seqDB search
MEGTSKSTIEDGPSVASQVPFLHLCTALEKIQKSKLRPEKSKILGDLIKSWRDFHSVLHK
GNLKTTDSFYPAMRLIVPPFERERMAYGIKESMLAKLYIDVLGLPKNGPEANKLLNYRAP
TTSQGEAGDFAGMAYFVLKKRCTSQGNLSIKEVNDFLDSVAANNAGKQKDLIKKSLLQLI
TQSSALEQKWLIRMILKDMKLGISKETVLHVFHPDAVELFNVNTDLNKVCQQLHDPSVSL
SEVSIGIFSAFKPMLAAVANIRNVEKQMGNSPFYIQTKLDGERIQLHKDGDVYKYFSRNA
YEYTQQFGGSPLEGSLTPYIHNVFKNHVVNCILDGEMMAYNPTTESFMQKGSKFDIKRLM
EDSELQTCFCVFDVLLVNNQKFGNETLRKRCEILQTVFNPVKGRIHMVPKTDARTMQEVV
DALNDAIDNREEGIMVKDPLSVYKPDKRGEGWLKIKPEYVDGLMDELDLLIVGGYWGKGR
RGGMMSHFLCAIAEAPKPGEKPSVFHSFCRIGSGYTMKELYDLGLKLAKHWKVYRKNDPP
SSILCGAERPEVYIEPCNSVIIQVRAAEIVGSDMYKTNCTLRFPRIEQIREDKEWHQCMT
LAELDQFRNKASGKLASRHLSISNDEPQKKKRKFAPKPKKVIGIMDHFKAQDLSGVKKET
DMFEDVEFCILNGTEDHPKAELEKGVARCGGVVVQNPGPDTYCVIAGAKNMRVKNLILSD
QHDVVWAWWLLECLDQKQVVPWQPRHMIHISPSTREQFAKEYDSYGDSYFVDTDVQQLQE
VFGRIPAAAAADTIDVGQVEQRFGWDNIPTSMFRPFTAYMDSCADLGDPDTLMPASCLDI
RALEFRFHGGTVLPTLEEGVSHVIITEETKMEELKTVRRRFTKKFKIVRDSWVTDSIRAG
HLLNDNIYLV
NT seq 2733 nt NT seq  +upstreamnt  +downstreamnt
atggaaggaacgtctaaaagcaccatagaggatgggccttcagttgcatcacaggttcca
tttcttcacctgtgtactgctttggagaaaatccaaaagtcaaagttacgtccagaaaaa
tccaagatccttggggatttaattaagtcgtggagagactttcattctgttctccacaaa
ggcaacttaaaaacaacagactccttctacccagccatgcgcctcatagttcctcctttt
gaacgagagcgaatggcatatggtatcaaagaaagcatgttagctaagctctacattgat
gtgttaggcctcccaaagaatggcccagaagccaataaactcctaaactaccgtgcccct
actacctcccaaggagaagctggagactttgctggcatggcatattttgtcttaaagaaa
cgatgcaccagccaaggaaacctcagcattaaagaggtcaacgactttctggactcagta
gctgccaacaatgcagggaaacaaaaggatctgataaaaaagagtctcctgcagctcatc
acccagagctcagctcttgagcagaagtggctgatcagaatgattctaaaggacatgaag
cttgggatcagtaaagagacagttcttcatgtctttcacccagacgctgtagaacttttt
aatgtcaacacagacttgaacaaagtgtgtcagcagcttcatgacccctctgtgtcatta
agtgaagtttctatcggaattttctctgcctttaagcccatgttggcagctgtggctaac
atacgcaatgtagagaaacagatgggcaatagccctttctacatccagaccaagctggat
ggagagcgcattcagctgcacaaagatggagatgtctacaagtattttagccgcaacgct
tatgaatacacacagcagtttggagggtcccctctggagggttcactgaccccttatatt
cataatgtttttaagaaccatgtagtgaactgcattctggatggggagatgatggcttac
aaccccactacagagagcttcatgcagaaaggaagcaagtttgacatcaagaggctcatg
gaggactcagagctgcagacgtgcttctgtgtcttcgacgtcctgttagtcaataaccag
aagtttggtaatgagacactgagaaaacgctgcgagatcctgcagacagttttcaaccca
gtgaagggaaggatccacatggtgccaaagactgatgcgagaaccatgcaggaggtggtg
gacgctctgaacgatgcaatagacaatagagaagaagggatcatggtcaaagatccatta
tctgtctataaacctgacaaacgaggggaaggatggctgaaaataaagccggaatacgtt
gatggattgatggacgagcttgacctcttgattgttggtggatactggggtaaaggaaga
cgaggtggaatgatgtctcatttcttatgtgccattgctgaagctcccaagcctggagag
aagccgtcagttttccactctttctgccgcattggctccggctacactatgaaggagttg
tatgatctcggtttaaagttagccaagcactggaaggtttaccggaaaaatgatccacca
tcatctatcctgtgtggagcagagagaccagaggtctacattgagccttgcaactctgtt
atcatccaagttagggcggctgagattgttggaagtgacatgtataaaaccaactgcaca
ctgcgcttcccaaggattgagcagatccgagaagacaaggagtggcaccagtgtatgact
ctggcagagctggatcagttccgcaacaaagcgtcaggaaaactagcttcgaggcatctt
agcatcagcaacgacgagccacaaaagaagaaacgcaagtttgcaccaaagcctaagaag
gtgattggtattatggaccacttcaaagctcaggacctttccggggtcaagaaggagacg
gatatgtttgaagatgtagaattctgcattctaaatgggacagaggaccatcccaaagct
gagctggagaaaggagttgcaaggtgtggaggagttgtggttcaaaaccctggaccagac
acctactgtgtgatcgctggtgccaagaacatgcgagtgaagaacctgattttgtccgac
caacacgatgtagtttgggcctggtggctgttggagtgtctcgaccagaaacaagtggta
ccctggcaaccgcggcacatgatccacatctcaccctctaccagggaacaatttgccaag
gagtacgacagctacggcgacagttactttgtggacacagatgtgcagcagctgcaggag
gtctttggccgcatccctgctgctgctgctgctgacaccatagacgttggtcaggtggag
cagcgttttggctgggacaacatccccactagcatgttcagacctttcacagcttacatg
gacagctgcgctgacctaggagaccctgacacgctcatgcccgcctcctgtttagacatc
agagctctggagtttcgcttccatggaggcacagtgctgccgacactggaggaaggtgtt
tcacacgttatcatcactgaagaaacaaagatggaggagctgaagacagtgaggagacga
ttcacaaagaagtttaagattgtaagagactcgtgggtgacagattcaatcagagcagga
catctgctcaatgataacatttacttagtttga

DBGET integrated database retrieval system