KEGG   Cynoglossus semilaevis (tongue sole): 103390155
Entry
103390155         CDS       T04866                                 

Definition
(RefSeq) mothers against decapentaplegic homolog 4-like
  KO
K04501  mothers against decapentaplegic homolog 4
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem04068  FoxO signaling pathway
csem04110  Cell cycle
csem04310  Wnt signaling pathway
csem04350  TGF-beta signaling pathway
csem04371  Apelin signaling pathway
csem04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:csem00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    103390155
   04350 TGF-beta signaling pathway
    103390155
   04371 Apelin signaling pathway
    103390155
   04068 FoxO signaling pathway
    103390155
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103390155
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    103390155
SSDB
Motif
Pfam: MH2 MH1 IRF-3
Other DBs
NCBI-GeneID: 103390155
NCBI-ProteinID: XP_016894074
UniProt: A0A3P8WLF0
LinkDB
Position
14
AA seq 503 aa
MSITNTPTSNDACLSIVHSLMCHRQGGESESFAKRAIESLVKKLKEKKDELDSLITAITT
NGAHPSKCVTIQRTLDGRLQVAGRKGFPHVVYARLWRWPDLHKNELKHVKYCQYAFDLKC
DSVCVNPYHYERVVSPGIDLSGLTLSSSGPLLVKDEYDYDNQQSHSSSESHLQTIQHPPS
RPGPQETFSSPTLLPPPESSSSASTSAFSTISAGPSNPTQNWSRSSSFTPAVPQHQNGHL
QHHPPMPHTGHYWPVTNEIAFQPPISNHPAPEYWCSIAYFEMDVQVGETFKVPSTCPIVT
VDGYVDPSGGDRFCLGQLSNVHRTENIERARLHIGKGVQLECKGEGDVWVRCLSDHAVFV
QSYYLDREAGRAPGDAVHKIYPSAYIKVFDLRQCHRQMQQQAATAQAAAAAQAAAVAGNI
PGPGSVGGIAPAISLSAAAGIGVDDLRRLCILRMSFVKGWGPDYPRQSIKETPCWIEIHL
HRALQLLDEVLHTMPIADPQPLD
NT seq 1512 nt   +upstreamnt  +downstreamnt
atgtcaatcacaaacactcccacgagtaatgatgcttgtctgagcattgtgcacagcctt
atgtgccaccgacagggaggggagagcgagagcttcgctaaacgggccattgagagtctg
gtcaagaagctgaaagagaagaaggatgaactggactccctcatcacagccatcactaca
aacggagcgcatcccagcaagtgtgtaaccatacagcggactttagacggacgccttcag
gttgcaggacgtaaaggtttcccgcatgtggtctacgcccgactttggcgatggcccgat
cttcacaaaaatgaattgaagcacgtgaaatattgccagtatgccttcgatctgaaatgt
gacagtgtttgtgtcaatccgtatcactatgaaagggtcgtctccccgggcattgattta
tcagggttgactctttcaagttcaggtcccctcttggtaaaggatgaatatgactacgat
aaccagcaatctcactccagctctgagagccacctgcagactatccagcatccgccatcg
aggcctggtccacaagagactttcagcagcccaactctactgcccccaccagagagcagc
agttcagcctcaacctctgctttctccaccatcagcgctggaccctcaaaccccacccag
aactggagcaggagcagcagtttcactcctgcggtgcctcagcaccagaatggtcatctc
cagcatcatccacccatgcctcacacaggacattactggccagtcactaatgaaattgcg
ttccagcctcctatatccaatcaccctgcaccagaatactggtgctctattgcttacttc
gaaatggacgtccaggtaggggagacgtttaaagtgccgtccacctgtcccatagtcacc
gttgatggctatgtggatccatcaggaggagaccgcttttgcctggggcaactgagcaac
gtacacaggacagaaaacattgaaagagccaggctccacattggtaagggcgtgcagctg
gagtgcaaaggtgaaggggatgtgtgggtgcgctgtttgagcgaccatgccgtgtttgta
cagagctactacctggaccgagaggcaggacgcgcccctggagatgctgttcacaagatc
taccccagtgcttacatcaaggtgtttgacttgcgtcagtgccacagacagatgcagcag
caggcggcgacggctcaggcagcagctgcggctcaggcagcagctgtggccggtaacatt
cctggacctggctctgtgggaggcatcgcccccgccatcagtttgtctgcagctgcaggc
atcggggtggacgacctgcgcaggctctgcatcctgaggatgagcttcgtgaaaggctgg
ggtcccgattaccctcgacagagcatcaaggaaacgccctgctggatcgaaatccattta
caccgagctctacagctgctggacgaagtcctgcacaccatgcccatagctgacccgcag
ccgctcgactaa

KEGG   Cynoglossus semilaevis (tongue sole): 103394304
Entry
103394304         CDS       T04866                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: mothers against decapentaplegic homolog 4-like
  KO
K04501  mothers against decapentaplegic homolog 4
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem04068  FoxO signaling pathway
csem04110  Cell cycle
csem04310  Wnt signaling pathway
csem04350  TGF-beta signaling pathway
csem04371  Apelin signaling pathway
csem04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:csem00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    103394304
   04350 TGF-beta signaling pathway
    103394304
   04371 Apelin signaling pathway
    103394304
   04068 FoxO signaling pathway
    103394304
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103394304
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    103394304
SSDB
Motif
Pfam: MH2 MH1 DUF1955
Other DBs
NCBI-GeneID: 103394304
NCBI-ProteinID: XP_008329772
LinkDB
Position
18
AA seq 615 aa
MWTDSELCHHDASEVSLADQLNTSVMSVNHPSSNDACLSIVHSLMCHRQGGENEGFAKRA
IESLVKKLKEKKDELDSLITAITTNGVHPSKCVTIQRTLDGRLQVAGRKGFPHVIYARLW
RWPDLHKNELKHVKFCQYAFDLKYDNVCVNPYHYERVVSPGIVGLSLQNTAAPGSLIKEE
YIPDCIQMDLPPGMPLTDHQSAPPEHYGQPLPPSQLPSEPHGPPPVSRYTNLPVSPKVSC
SGSMLPLQAGHNDGHLQTGSPQAQVMTPAPRPPTPTRTPPHAQAAQQPPQASHSLQPPSN
SHGQNGYNSNKHSQSQPVFHTVWTGNNTASYTPIGPQQNGRVLQQPPLHHPNHHCKSLQL
FXTEQQWHXXXSFPPSVSNHPGPEFWCSISYFEMDVQVGEMFKVPSSCPVVTVDGYVDPS
GGDRFCLGQLSNVHRTDASERARLHIGKGVQLECRGEGDVWMRCMSDHAVFVQSYYLDRE
AGRAPGDAVHKIYPGAYIKVFDLRQCHRQMQQQAATAQAAAAAQAAAVAGNIPGPGSVGG
IAPAVSLSAAAGIGVDDLRRLCILRLSFVKGWGPDYPRQSIKHTPCWVEVHLHRALQLLD
EVLHTMPLADPGTAN
NT seq 1848 nt   +upstreamnt  +downstreamnt
atgtggacagattcagagctgtgccatcacgatgccagtgaagtttcattggctgaccaa
cttaacactagcgtcatgtccgtaaaccacccaagcagcaacgacgcctgcctcagcatc
gtccacagcctgatgtgccatcggcagggtggagagaatgaaggcttcgccaaacgtgcc
attgagagcctggtgaagaagctgaaggaaaagaaggacgagctggactcactcatcact
gccatcacaactaacggtgtccacccgagcaagtgtgtcacaatccagaggacactcgac
ggacggttgcaggtggcagggagaaaaggtttccctcatgttatttatgcccgactgtgg
cgttggcccgacctccacaagaacgaactgaagcacgtaaagttctgccagtatgccttt
gacctgaaatatgacaacgtgtgtgtcaacccgtaccattatgagagagtggtatctcca
ggcattgtcggcctcagcctccagaacacagcagctcccggcagcctcatcaaagaggaa
tatatccccgactgcatacagatggaccttcctccaggcatgcctctgacggaccatcaa
tcagcgcctccggaacactatggccagcctctgcctccctcacagctaccgtcagagcca
cacggaccgccgcctgtcagcagatacacaaacctgcctgtctcacccaaagtgtcctgc
tctggctccatgctgcccctgcaggcaggacacaatgacggccatctccaaactggatcc
ccacaggctcaagtcatgacgccggcccctcgacctccgactccaacccgaactccgcct
cacgcacaggcagcccaacagccgccacaggcctcccattcactgcaacccccatccaac
tctcatggacagaacggctacaacagcaataaacactctcaaagccagccagttttccac
actgtttggacaggcaacaacacagcctcctacactccgataggaccccagcagaatgga
cgcgttctgcaacaaccacccctacatcacccaaaccaccattgtaagtctttgcaactc
ttttaaactgagcaacaatggcactgnnnnnnntctttccctccttctgtgtcaaatcat
ccaggcccagagttttggtgctcgatctcctactttgaaatggacgtccaagtaggtgag
atgttcaaagtgccgtccagctgtcccgtggtgactgtggatggttacgttgacccatcg
ggaggtgaccgcttctgcctgggtcagttgagcaacgttcaccgtaccgatgccagtgag
agggccaggttacacataggcaaaggggtgcagttggaatgtcgcggcgaaggcgacgtg
tggatgcgctgcatgagcgaccacgctgtatttgtgcaaagctactacctcgacagagag
gcgggacgtgcgccaggtgatgcggtgcacaagatctatcccggagcctatatcaaggtg
tttgacctgcggcagtgccacagacagatgcagcagcaggcagccacggctcaggctgcg
gcagctgcacaggcagccgctgtagcgggaaacatcccaggtccaggcagtgtgggaggc
atagctcctgcagttagtctgtcagcggcagctgggatcggcgtggacgacctgaggcga
ttgtgtattctgcgactcagcttcgtgaagggctgggggccggactaccctcgacagagc
atcaaacacaccccctgctgggtggaggtccacctgcaccgtgctctgcaacttctagac
gaggtgttgcacactatgccgttggccgacccagggacggcaaactga

KEGG   Cynoglossus semilaevis (tongue sole): 103397887
Entry
103397887         CDS       T04866                                 

Definition
(RefSeq) mothers against decapentaplegic homolog 4-like
  KO
K04501  mothers against decapentaplegic homolog 4
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem04068  FoxO signaling pathway
csem04110  Cell cycle
csem04310  Wnt signaling pathway
csem04350  TGF-beta signaling pathway
csem04371  Apelin signaling pathway
csem04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:csem00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    103397887
   04350 TGF-beta signaling pathway
    103397887
   04371 Apelin signaling pathway
    103397887
   04068 FoxO signaling pathway
    103397887
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103397887
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    103397887
SSDB
Motif
Pfam: MH2 MH1 IRF-3
Other DBs
NCBI-GeneID: 103397887
NCBI-ProteinID: XP_008334526
UniProt: A0A3P8V917
LinkDB
Position
Z
AA seq 510 aa
MSITNTPTSNDACLSIVHSLMCHRQGGESETFSKRAIESLVKKLKEKKDELDSLITAITT
NGAHPSKCVTIQRTLDGRLQVAGRKGFPHVIYARLWRWPDLHKNELKHVKYCQFAFDLKC
DSVCVNPYHYERVVSPSIDLSGLTLTTPHSGSGLVVKDEYDFDGPQNVPSMDGGHSIQTI
QHPPSSSRGAPAESFAVPNLLSPAETSTSSSTSSFPAIAAGSSSASSSWSRNSTFPSNIS
HHSNGHLQHHPPMPHPAHYWPVHNELAFQPPLSNHPAPDYWCSIAYFEMDVQVGEMFKVP
SSCPIVTVDGYVDPSGGDRFCLGQLSNVHRTEAIERARLHIGKGVQLECKGEGDVWVRCL
SDHAVFVQSYYLDREAGRAPGDAVHKIYPSAYIKVFDLRQCHRQMQQQAATAQAAAAAQA
AAVAGSIPGPGSVGGIAPAISLSAAAGIGVDDLRRLCILRMSFVKGWGPDYPRQSIKETP
CWIEIHLHRALQLLDEVLHTMPIADSQPLD
NT seq 1533 nt   +upstreamnt  +downstreamnt
atgtctatcaccaatacaccgaccagcaatgatgcctgtctgagcatcgtgcatagccta
atgtgccacagacaggggggtgagagtgagacattttccaaacgtgccatcgagagcttg
gtgaaaaagctgaaggagaaaaaagacgagcttgactcactcattacggctattaccacc
aacggtgcccatcccagcaagtgtgtgactattcagaggacacttgatggaagactgcag
gtggcaggacgtaaagggttccctcatgtcatctacgctcggctgtggcggtggcctgac
cttcataaaaatgagctcaaacatgtcaaatactgccagtttgcttttgacctcaagtgt
gacagtgtgtgtgtcaacccctatcactatgagagggtggtgtctcccagcatagactta
tcaggtctgaccctcaccactcctcactccggctcaggccttgttgttaaagatgagtat
gattttgatggaccacagaacgttccttccatggacggaggacactccatccaaactatc
cagcatcctccgtccagcagccgaggagcgcctgcagaatcatttgcagttccaaacctg
ctttcacctgctgagacctccacctcatcctcgacgtcatccttccctgccatcgctgct
ggatcgagcagtgcctcctcctcctggtcaaggaacagcaccttcccctctaacatatcg
caccacagcaacggtcacctacagcaccacccaccaatgccacacccagcacattactgg
ccagtgcacaatgagcttgccttccagcctcccctatcaaatcatccagcccctgactac
tggtgttccattgcctactttgagatggacgttcaggtcggtgagatgttcaaagtgccc
tcttcttgtcccattgtgacagtggatggctatgtggacccctccggaggagacaggttc
tgtttgggccagctgagtaacgttcatcgcactgaagccatagagagagctcggcttcac
attggtaagggagtccagctggagtgtaagggtgagggtgatgtgtgggtgcgctgcctt
agtgaccacgcagtgtttgtccagagttattacctggacagagaagcaggtcgagctcca
ggagatgctgttcacaaaatctacccaagtgcttacatcaaggtgtttgaccttcggcag
tgtcacagacagatgcagcagcaggcggccacagctcaggcagcagcagcagctcaggca
gcagctgtagctggaagtatacctggtcctggatcagtcggaggcatagctccagctata
agtctgtcagcagcagcaggtattggtgtggacgacctacgcaggctgtgtatcctcagg
atgagttttgtgaagggctgggggcctgactaccctcgacagagcatcaaggagaccccc
tgctggatcgagatccacctgcaccgagccctgcagttactggatgaggttcttcacacc
atgcctatagcagactcacagccactggactga

DBGET integrated database retrieval system