KEGG   Cynoglossus semilaevis (tongue sole): 103390173Help
Entry
103390173         CDS       T04866                                 

Gene name
abl1
Definition
(RefSeq) tyrosine-protein kinase ABL1 isoform X1
  KO
K06619  abelson tyrosine-protein kinase 1 [EC:2.7.10.2]
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem04012  ErbB signaling pathway
csem04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:csem00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    103390173 (abl1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103390173 (abl1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:csem01001]
    103390173 (abl1)
Enzymes [BR:csem01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     103390173 (abl1)
Protein kinases [BR:csem01001]
 Non-receptor tyrosine kinases
  ABL family
   103390173 (abl1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase F_actin_bind SH2 SH3_1 SH3_9 SH3_2 SH3_3 Haspin_kinase SH3_6
Motif
Other DBs
NCBI-GeneID: 103390173
NCBI-ProteinID: XP_008324136
UniProt: A0A3P8WGM2
LinkDB All DBs
Position
14
AA seq 1113 aa AA seqDB search
MGQQPGKFAGDQRRPSLPAFIKGGKRESSRHGTQSCNVFAVHEALQRPDLEGQGLTEAAR
WNSKENLLAGPSENDNNLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNG
QGWVPSNYITPVNSLEKHSWYHGPVSRNAAEYLLSSGINGSFLVRESESSPGQRSISLRY
EGRVYHYRINTASDGKLYVSSESRFNTLAELVHHHSTVADGLITTLHYPAPKRNKPTIYG
VSPNYDKWEMERTDITMKHKLGGGQYGEVYEGVWKKYNLTVAVKTLKEDTMEVEEFLKEA
AVMKEIKHPNLVQLLGVCTREPPFYIITEFMTHGNLLDYLRECNREEVNAVVLLHMATQI
SSAMEYLEKKNFIHRDLAARNCLVGENHLVKVADFGLSRLMTGDTYTAHAGAKFPIKWTA
PESLAYNKFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSLVYELLEKNYRMDRPEGCPEK
VYELMRACWRWNPLERPSFAETHQAFETMFQESSISDEVEKELGKKGKKATLGSIQQAPE
LPTKTRTLRRNMDNRDGDSPDPTDPEAVVSSPMLPRKERTPLDGNLNDDDRLIPKDKDKT
RGSVLLNLIKIKKNKVPPPPKRSSSFREDMHHERRCVTLEPRDNDSFNNGASLTINESTH
GPDSSKLLGTNNNGAASITNGAPTYPGPFFPRKKVPAAPGPGGKAATTPPGEEETMSNSK
RFLWSSSVPCGSDGSEWRSVTLPRDLGQRHFDSGTFGGKPALPRKKTNEQKRDGAPRMGT
LTPPPRLNSSDVSSAFMGKDSDHSPGSSPKALTPKADRRPGFPGLENSKTSALQAELLKP
NVFPALGAAGDECRARRKKEPVDSVRERGKIQKPKPAPPPPPANSKPSKVSRSPTQELPS
PSSTSDFKAKGLSSVSEAHHTTTVSDQAGSPLNEGSKKSHLGSSSKPQPLKTSSSVTTSL
SSQSLGGFSSPLASPGDQSSLTAFIPLVNTRRSLRKIAPRQASERTSNSAATRDMVLEGT
ELLRAAICRNSEQTGSHSAVLEAGKNLSKYCMSYVDSIQQMRNKFAFREAINKLESSLRE
LQICPTATGGANSQQDFSKLLSSVKEISDIVQR
NT seq 3342 nt NT seq  +upstreamnt  +downstreamnt
atggggcagcagccggggaagtttgcaggggaccagaggagacccagtctgccagccttc
ataaagggtgggaagagagaatcatcacgccatgggacgcagtcctgcaatgtttttgct
gtgcacgaagctcttcagagaccagaccttgagggtcagggtctgaccgaagcggcccgc
tggaattccaaagagaacctgttagctggacccagcgagaatgacaacaacctgttcgtg
gcactgtacgacttcgtggccagcggtgacaacacactcagcatcaccaaaggtgagaag
ctgcgcgtgctgggttacaaccacaacggtgagtggtgcgaggcgcagaccaagaatggc
cagggctgggtaccgtccaactacatcaccccggtcaacagcctggagaagcacagctgg
taccacggccccgtgtcacgcaacgctgccgagtacctgctcagctccggcatcaacggg
agcttcctggtccgcgagagcgagagcagcccgggtcagaggtcaatatctctgcgatac
gagggccgagtctaccattacaggattaacactgcgtctgacggcaagctgtacgtctcc
tctgaaagtcgcttcaacacactggcggagctggtgcaccaccactccacggtggccgac
ggcctcatcaccacgctgcactacccggctccgaagcggaacaagcccacgatctacgga
gtttcgcccaactacgacaagtgggagatggagcgcactgacattaccatgaaacacaag
ctgggaggggggcagtacggggaggtgtacgagggggtgtggaagaagtacaacctgact
gtggccgtcaagacgctaaaggaagatacgatggaggtggaagagtttctgaaagaggcc
gctgtcatgaaagagatcaaacaccccaacctggtgcagttattaggtgtgtgcacgcgg
gagccaccgttctacatcatcacagaattcatgacccacgggaacctgctggactacctg
agggagtgcaacagggaggaggtgaacgccgtggtgctactccacatggccacgcagatt
tcctccgccatggagtacctggagaaaaaaaacttcatacacagggacttggcagctcgg
aactgcctggtgggggagaaccacctggtgaaggttgcagacttcggtctgagcaggtta
atgacaggagacacctacacagctcacgctggagccaagttccccatcaagtggaccgca
ccagagagtctggcctacaacaagttctccattaagtccgatgtctgggcgtttggggtc
ctactgtgggagatcgccacctacggcatgtccccttacccaggcatcgacctgtccctg
gtctacgagctgctggagaaaaactatcgcatggaccgaccagagggctgccccgagaag
gtctacgagctgatgagagcctgttggaggtggaaccctttagaacgtccatcgtttgct
gaaacacaccaggctttcgagaccatgttccaggagtccagcatctccgacgaagtggag
aaggagctgggcaaaaagggaaagaaggcaacgttaggatccatccagcaggctccggag
ctgcccaccaagaccaggactctccgcaggaacatggacaacagggatggagacagtcca
gatcccaccgacccagaggcggttgtctcctcgccgatgctacccaggaaagagaggacg
cccctggacggcaacctgaacgacgacgaccgcttgatacccaaagacaaggacaagacc
cgtgggagtgtgctgctcaacctcatcaagataaagaaaaacaaagtgccgcctccgccc
aaacggagctcctccttcagggaggacatgcaccacgagaggaggtgcgtcaccttagag
ccccgtgacaacgacagctttaacaatggcgcgtctctgactattaatgaatccacgcac
ggccccgactcctccaaactcctcggtactaacaacaacggagcagcgagtatcacaaac
ggtgctcccacctacccgggaccatttttccccaggaagaaggtccctgcggcgcctggt
ccaggaggcaaggccgctacaacgccacccggtgaggaggagaccatgtccaactccaaa
cgtttcctctggtcctccagcgtaccctgtggctcagacggcagcgagtggaggtccgtc
acgctcccgcgagatctgggccagcgccactttgactcgggtacctttggcggcaagccg
gctctgccgcgcaaaaaaaccaacgagcagaaaagggacggcgctcctcggatgggcacc
ctgacgcccccgccgcgtcttaactcctccgatgtttcctccgccttcatgggaaaagac
agtgatcacagcccggggtcgagtcccaaggctttaacacccaaggcggacaggagaccg
gggtttccaggcctggagaactctaaaaccagcgctctgcaggccgagcttctcaagccc
aacgtgttccctgctctgggagcggctggagacgagtgcagagcccgcaggaaaaaggag
ccggtggactccgtcagggaacgagggaagatacagaaacccaaacctgccccgcctcca
ccgcccgccaactccaaacctagcaaggtctctcgcagccccactcaagaactcccttca
ccctcctccacttcagacttcaaagctaagggtctctcctctgtgtctgaggcccaccac
acaaccactgtcagtgaccaagccggctcgccacttaacgagggctccaagaagtcgcac
ctgggctcctcctccaaacctcaaccgttgaaaacctcctcctcggtgacgacatccctc
tccagtcagagtttaggaggcttctcttcccctctggcctcacccggggaccagagttcc
ctcaccgctttcatcccgctagtcaacacccggcgctctctccgcaagattgcaccccgc
caggcctccgagcggacctccaactcggccgcgacccgggacatggtgctggagggcacc
gagctgctgcgggcggccatatgccggaactcggagcagacgggcagccacagcgccgtc
ctggaggccggcaagaacctgtccaagtactgcatgagctacgtggactccatccagcag
atgaggaacaaatttgccttccgcgaggccatcaacaagctggagagcagcctgcgtgag
ctgcagatctgcccaactgccactgggggtgccaattcgcagcaggactttagcaagctg
ctttcctctgtcaaagaaatcagtgacattgtccagaggtag

DBGET integrated database retrieval system