KEGG   Cynoglossus semilaevis (tongue sole): 103390898
Entry
103390898         CDS       T04866                                 

Gene name
fbxw11
Definition
(RefSeq) F-box/WD repeat-containing protein 11
  KO
K03362  F-box and WD-40 domain protein 1/11
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem04114  Oocyte meiosis
csem04120  Ubiquitin mediated proteolysis
csem04218  Cellular senescence
csem04310  Wnt signaling pathway
csem04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:csem00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    103390898 (fbxw11)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    103390898 (fbxw11)
   04340 Hedgehog signaling pathway
    103390898 (fbxw11)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    103390898 (fbxw11)
   04218 Cellular senescence
    103390898 (fbxw11)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:csem04121]
    103390898 (fbxw11)
   03036 Chromosome and associated proteins [BR:csem03036]
    103390898 (fbxw11)
Ubiquitin system [BR:csem04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     103390898 (fbxw11)
Chromosome and associated proteins [BR:csem03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Regulators of centriole replication
     103390898 (fbxw11)
SSDB
Motif
Pfam: WD40 Beta-TrCP_D ANAPC4_WD40 F-box-like WD40_like F-box Nup160 WD40_2
Other DBs
NCBI-GeneID: 103390898
NCBI-ProteinID: XP_016895074
UniProt: A0A3P8VC47
LinkDB
Position
15
AA seq 562 aa
MEPEIEDKTLELMCSVPRSLWLGCSSVAESLCALRCLQSIPSTRAHNQNTSGMESPNLVD
DLSPKKNTVLWLTNGPVMGSRKRPSEGNYEKEKEHCIALFDQWSEADQVEFVERLISRMC
HYQHGHINSYLKPMLQRDFITALPAQGLDHIAENILSFLDARSLCSAELVCKEWQRVISE
GMLWKKLIERMVRTDPLWKGLSERHQWEKYLFKNRTSEVPPNSYYHSLYPKIIQDIETIE
ANWRCGRHNLQRIQCRSENSKGVYCLQYDDDKIISGLRDNSIKIWDKQTLECLKILTGHT
GSVLCLQYDERVIVTGSSDSTVRVWEVMTGEVLNTLIHHNEAVLHLRFANGLMVTCSKDR
SIAVWDMASPTDISLRRVLVGHRAAVNVVDFDDKYIVSASGDRTIKVWSTSTCEFVRTLN
GHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGA
YDGKIKVWDLQAALDPRAPASTLCLRTLVEHSGRVFRLQFDEFQIISSSHDDTILIWDFL
NVSTNGQSEGRSPSRTYTYISR
NT seq 1689 nt   +upstreamnt  +downstreamnt
atggagccggagatagaggacaaaacgttggagctgatgtgctctgtgcctcgctctctc
tggctgggctgctcctcggtggctgagagtttgtgtgcactcaggtgcctgcagagcatc
ccctccacccgggctcacaaccagaacacatcaggaatggagtcaccgaaccttgtggat
gatctatcgccaaagaagaacactgttctctggcttactaatggtcctgtgatgggctcc
cgcaagcgtccttcggagggaaactatgagaaggagaaagaacactgcatcgcactgttt
gaccagtggtcagaggcagaccaggtggagtttgttgagcgcctgatctcccgtatgtgc
cactatcagcacggtcacatcaactcctacctcaaacctatgctgcagagggactttatc
actgcgctgccagcccaaggcttggatcacatagcagagaacatactgtcgttcttggat
gcccgctcgctttgttcggcagagctggtgtgtaaggagtggcagcgggtcatctctgag
ggtatgctgtggaagaagctcattgaacgcatggtccgcaccgacccactctggaaaggc
ctgtctgagagacatcagtgggaaaagtacctatttaagaaccgcacatcagaagttcca
cccaactcctactatcactccctttatcccaagatcattcaagacatagagactattgag
gctaattggcgatgtggacgacacaacctgcagaggattcagtgtcgctcagaaaacagt
aaaggggtttactgtctccagtatgacgatgacaagatcatcagtggccttagggacaat
tctataaagatctgggataagcagactctcgagtgtctaaagatactgaccggtcacaca
ggctcagtgttgtgtctgcagtatgatgagagggtcatcgtcactgggtcatctgactca
accgtcagggtgtgggaggtaatgaccggtgaggtactaaacacacttatccaccacaat
gaagctgtgcttcacctgcgctttgcgaacggcttgatggtcacctgctccaaagaccgt
tcgattgcagtttgggacatggcctcacccacagacatcagcctccgtcgggtcttggtt
ggacacagggccgctgtcaatgtggtcgattttgatgacaaatacattgtgtctgcttct
ggcgatcgcaccattaaggtatggagcaccagcacctgcgagtttgtccgcactctaaat
ggtcacaagcggggtatcgcctgtctacagtatagagatcgccttgtcgttagtggctcg
tctgacaacacaatccggttatgggatattgaatgtggcgcttgtttgcgagttctggaa
ggtcacgaggagttggtgcgctgcatccgctttgacaacaagaggattgtgagcggcgcc
tacgatggaaaaattaaggtgtgggacctgcaggcagccctggacccacgagccccagca
agcacattatgtctgcgcactcttgtggagcattctggtcgcgtgttccgtctacagttt
gatgagtttcaaatcatcagcagttctcatgacgacaccattctgatctgggacttcttg
aacgtctcaaccaacgggcagtcagagggacggtctccctcccgcacctacacatacatt
tcgagatag

DBGET integrated database retrieval system