KEGG   Cynoglossus semilaevis (tongue sole): 103391052
Entry
103391052         CDS       T04866                                 

Gene name
epo
Definition
(RefSeq) erythropoietin
  KO
K05437  erythropoietin
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:csem00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103391052 (epo)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:csem04052]
    103391052 (epo)
Cytokines and growth factors [BR:csem04052]
 Cytokines
  CSF and other factors
   103391052 (epo)
SSDB
Motif
Pfam: EPO_TPO
Other DBs
NCBI-GeneID: 103391052
NCBI-ProteinID: XP_016892999
UniProt: A0A3P8W212
LinkDB
Position
1
AA seq 204 aa
MSNRRTYVPNRKEPVRGYEDTAMEFPRLLALLLILLEWTQTGLLYPLRPICDRKVLELFI
KEARDAEDAMKSCSDGCSLSNSVTVPKTQVVLDLWEHKNELEKAQEVQSGLWLIEKALNL
LRTNVRNTALHSHIDNSIRNLGSLNAVLLRLNIQEYVPPTNTADISGTWGTSSATDLFPV
YINFLRGKVNLLLKEAQACQTDVS
NT seq 615 nt   +upstreamnt  +downstreamnt
atgagcaatagacggacctatgtgccaaaccgcaaggagccagtgagaggctatgaagat
accgctatggagtttcccagacttctcgccttgttgctgattttgctggagtggacccag
acaggtctcctgtaccctctcaggccgatctgcgaccggaaggtcctagaactcttcata
aaagaggcaagagatgctgaagatgctatgaagtcctgcagtgatggatgcagcctatca
aactctgtcacagttcctaaaacccaagtcgtcttagacttatgggaacataaaaacgaa
cttgagaaagcccaggaggtgcagtctggcctatggcttatagaaaaggccctgaatttg
ctacggaccaacgtcagaaacacagcactgcacagccatatagacaactctattagaaat
ctgggcagcctcaacgctgttctgcttcgtctcaatatccaggaatatgttcctcctaca
aatacagccgatatcagtggaacatggggaacctcctctgcaacagatctctttccggtc
tacatcaacttcttgcgaggcaaagtgaacctccttctcaaagaggcacaggcttgtcag
actgatgtcagctga

DBGET integrated database retrieval system