KEGG   Cynoglossus semilaevis (tongue sole): 103391186
Entry
103391186         CDS       T04866                                 

Definition
(RefSeq) glucocorticoid receptor
  KO
K05771  glucocorticoid receptor
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:csem00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    103391186
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:csem03000]
    103391186
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:csem03310]
    103391186
Transcription factors [BR:csem03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    103391186
Nuclear receptors [BR:csem03310]
 3. Estrogen like
  3C. 3-Ketosteroid receptor
   103391186
SSDB
Motif
Pfam: GCR Hormone_recep zf-C4
Other DBs
NCBI-GeneID: 103391186
NCBI-ProteinID: XP_016894865
UniProt: A0A3P8WGG5
LinkDB
Position
15
AA seq 762 aa
MDKGGVKKITYRRDDHLTKLVYTESPEVGGLLKVAPHTAMPISSAATIALPPSPLMQPGQ
IPNGLSNSPLPQELSPITANATLGPLLTKDPRIQRQQSRPIQTSTTFGLQTLSHTLPQFE
GSIVDITQSSMDSLIGGSDPNFFPMRTEDFSMDKGDQDMIDPLEVSQKLFSENALDLLQD
FDLTGSPSDFYVGDDAFLSTLADDSLLGDVGSDRDIKPAMLESNIGSSSVSVAISGSIMS
SPVQSSTSLSTNTSPTTFPTILSPFVKEEKDPDIIQLCTPGVIKQEKTSTGQSHCQISGS
NPVSICGVSTSGGPSYHFGVSPSSSDAQQHKDQKPVSKFILPVTTISGTWNRVQDVGNGS
VLPRGNESFSSSPTFPTTFASSTSRQEGGSSASPGQGKSTVHKICQVCSDEASGCHYGVL
TCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPACRFRKCLVAGMNLEARKVKKM
NRLKGVQQSNPPELLTPPLEEPLALLPKCLPQLVPTMLSLLKAIEPETIYAGCDSTTAIT
STRLMTTLNRLGGKQVVSAVKWAKALPGFRKLHLDDQMTLLQCSWLFLMSFSLGWRSYQQ
CNGNMLCFAPDLVINEERMKLPYMADQCEMMLKISSEFVRLQVSHDEYLCMKVLLLLSTV
PKDGLKSQAVFEEIRMNYIKELGKAIVKREENSSQNWQRFYQLTKLLDSMHEMVGGLLDF
CFYTFVNKSLSVEFPEMLAEIISNQLPKFKAGSVKPLLFHQR
NT seq 2289 nt   +upstreamnt  +downstreamnt
atggacaaaggtggagtgaagaagatcacatacagaagagatgaccatttaaccaagttg
gtctacactgaaagccctgaggtgggaggtctgctgaaagtggctcctcacactgctatg
cccatctcctctgctgcaaccatcgctcttcctcccagcccattaatgcagccaggacag
ataccaaacggcctcagcaatagcccccttccacaggagctctcccccatcactgccaac
gccacacttggacccttgttgacgaaagatccgagaattcaacggcagcagtcacgcccg
atacagacatccaccacatttggacttcagaccctaagccatactttgcctcagtttgag
ggcagtatagtagacattacccagtcctccatggattcacttattgggggatcagatcct
aactttttcccaatgagaacagaggatttctcaatggataagggagaccaagatatgatt
gatccccttgaagtaagccaaaagttgttcagtgaaaatgccctagaccttctccaggac
tttgatctcactggatccccctcagatttttatgttggcgacgatgccttcctgtcaaca
ctggcagatgattcccttcttggggatgttggctcagacagagatattaaacctgccatg
ctcgagagcaacattggaagtagctctgtctccgttgctatcagtggcagcataatgagt
agtccggttcagtccagcactagcctgtccaccaacacttcccccacaacttttccgacc
attttgtctccatttgtaaaggaagagaaagatcctgacataattcagctctgcaccccg
ggtgtgatcaaacaggagaagacatctactggacagagtcattgtcaaattagtggctca
aatcccgtttccatctgtggggtcagcacatcaggaggaccaagctaccactttggagtc
agccccagcagcagtgacgctcagcagcataaggatcagaagccagtgtccaaatttatt
cttccagtgacgacaattagtggaacctggaatagagtccaggacgttggaaacggctcg
gttttgccaagaggcaatgaatctttctccagctcacccaccttccccaccacttttgca
agttctacctccagacaagaagggggctcctccgcatcaccaggtcaggggaaaagcacc
gttcacaaaatctgccaagtttgctctgacgaagcgtctggctgccactacggcgttctc
acgtgcggcagctgtaaggtgttctttaagcgagcagtggaagggcagcataattacctg
tgtgctgggagaaatgactgcattatagacaagatcaggaggaagaactgccccgcctgc
cgcttccgcaagtgtctggtggcaggcatgaacttggaagctcgaaaagtcaagaaaatg
aaccgcttaaagggcgtgcagcagagcaacccgcccgagttgctgacacctcccctggaa
gagcctctcgccctgcttccaaagtgcctgcctcagctggttcccaccatgctgtccctg
ctaaaagccatcgagccggagaccatctacgccggctgcgacagcaccaccgccatcacc
tccacccgcctcatgacaaccctgaacagactgggcggcaaacaagtcgtctctgccgtc
aagtgggccaaagctctgccaggtttcaggaagctgcacctggatgaccagatgaccctg
ctgcagtgctcctggctcttcctcatgtccttcagtctgggctggcgatcttaccaacag
tgcaacggcaacatgctctgtttcgcacctgacctggtcattaacgaggagaggatgaag
ctgccctacatggctgaccagtgtgagatgatgctgaagatttccagcgagttcgtcagg
ttgcaggtttcccacgacgagtacttgtgcatgaaggtcctgctgctgctcagcacagtg
ccgaaggatggtctgaagagccaggcagtgtttgaggagatcaggatgaactacatcaag
gagcttggaaaagccatagtgaagcgcgaggagaactccagccagaactggcagcgtttc
tatcagctcaccaagcttctcgactccatgcacgagatggttggaggactgctcgacttc
tgcttctacacctttgtgaataaatccctaagtgtggagttcccagagatgctggcggag
atcatcagcaaccagttaccaaaattcaaggccgggagcgtcaaacctctcctctttcac
cagagatga

DBGET integrated database retrieval system