KEGG   Cynoglossus semilaevis (tongue sole): 103391355
Entry
103391355         CDS       T04866                                 

Gene name
sirt1
Definition
(RefSeq) LOW QUALITY PROTEIN: NAD-dependent protein deacetylase sirtuin-1
  KO
K11411  NAD+-dependent protein deacetylase sirtuin 1 [EC:2.3.1.286]
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem00760  Nicotinate and nicotinamide metabolism
csem01100  Metabolic pathways
csem04068  FoxO signaling pathway
csem04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:csem00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    103391355 (sirt1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    103391355 (sirt1)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    103391355 (sirt1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:csem03036]
    103391355 (sirt1)
   03029 Mitochondrial biogenesis [BR:csem03029]
    103391355 (sirt1)
Enzymes [BR:csem01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.286  protein acetyllysine N-acetyltransferase
     103391355 (sirt1)
Chromosome and associated proteins [BR:csem03036]
 Eukaryotic type
  Histone modification proteins
   HDACs (histone deacetylases)
    SIRTs (sirtuins, class III HDACs)
     103391355 (sirt1)
Mitochondrial biogenesis [BR:csem03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    103391355 (sirt1)
SSDB
Motif
Pfam: SIR2 TPP_enzyme_M DUF592
Other DBs
NCBI-GeneID: 103391355
NCBI-ProteinID: XP_008325814
LinkDB
Position
15
AA seq 697 aa
MQMSQLXERKSARQRRDGLKMADGEDGLGTGLSGALGMDGPVAKRSKTAPGTNCGFKVAE
AEQFMCASADTENWEAAAVDCAQPAGKEAKPVMAVEQAPAAALGEDNNELSASYGPAVKL
GDSAMLGTNEEAPDFHEHDDFASNGLAVTPDHITEEDDRSSHASSSDWTPQPQIGSYSFI
QQHIRETDPRTILRDLLPETVLPPDLDDMTLWQIIINISEPPKRKKRKDLNTLEDVVRLL
QESKRILVLTGAGVSVSCGIPDFRSRDGIYARLAVDFPDLPDPQAMFDIDYFRRDPRPFF
KFAKEIYPGQFQPSPCHNFISMLDKQGKLLRNYTQNIDTLEQVAGVERIIQCHGSFATAS
CLICKHKVDCDTIREDIFNQVVPHCPKCPDIPLAIMKPDIVFFGENLPEMFHRAMKQDKD
EVDLLIVIGSSLKVRPVALIPNSIPHDVPQVLINREQLPHLNFDVELLGDCDVIINELCH
RLGGDFEQLCFNTVRLTEITEKPPRFPEQLPSEVLPASSDTVQEEQEQNSTHSVVKPSED
TENLHVTETAGNNLLPPVDLPAEGVEKEEAAEIRNPTSNLEFRRRFWISRINRSPISKRL
DAGQYLFQAPNHYIFHGAEVYSDSEDETSSSCGSDSEESECSGSGLEDNSEPEDADTRPV
DEETHPRDTIQHTVATADASSVQIDNTFEKIQNTTHL
NT seq 2094 nt   +upstreamnt  +downstreamnt
atgcaaatgagccagctgtaggagagaaagtctgctcggcagcggcgcgacgggctgaag
atggcggacggcgaagacggtctcggtactgggctttcgggcgccctcggaatggacgga
ccggtcgcaaaaagatcgaaaactgcaccgggcacaaactgcggattcaaagttgctgaa
gcagaacaatttatgtgtgcctctgcggacacagagaactgggaggcggcggcggtggat
tgtgcgcagccagcggggaaagaagcaaagccggtgatggcggtagagcaggccccagca
gcagcgctaggtgaagacaacaatgaactctccgcgtcctatggaccagccgtgaaactg
ggagacagtgccatgctgggcacaaacgaggaggctccggattttcatgaacatgatgat
tttgcttccaatggtttggcagtgacaccagaccacatcacagaggaagatgacagatcc
tctcatgccagttccagtgactggacccctcagccccaaataggatcatacagtttcatc
cagcaacacatcagagagactgatccaaggaccatcctgagggacctgctgcctgagacc
gtgctcccaccagatttagatgatatgacattgtggcagattatcataaacatctcagaa
cctccaaagagaaagaaacggaaggaccttaacacactggaagatgtggtgagactcctc
caagaaagtaaaaggatccttgtgctgacgggtgctggggtgtctgtttcctgtggaata
ccagactttcgctcaagggatggaatttatgcacggttagctgtagattttccggatctt
ccagaccctcaagcaatgtttgacattgattacttcagacgggatccaagaccttttttt
aagtttgctaaggagatttatcctggtcagtttcagccatcgccttgtcataacttcata
tctatgcttgataaacaagggaagctactgcgcaattacacacaaaacattgatacttta
gaacaagtggcaggggtggagcggatcatccagtgtcacggctcatttgcaacggcatct
tgcctcatctgtaaacacaaagtggactgcgataccataagagaagatatcttcaaccag
gttgttcctcattgtccaaagtgtccagatatcccactggcaatcatgaagcctgatatt
gttttctttggtgagaatcttccagaaatgttccacagagccatgaagcaggacaaagat
gaagtggatcttttgattgtcattggttcttctcttaaagtccgtcctgttgccctcatc
ccaaattctattcctcatgacgtgcctcaggtcttgatcaacagagagcagctccctcac
ctcaactttgatgtggagttacttggggactgcgatgtcattatcaatgagctctgtcat
cgtttgggtggagactttgagcagctctgcttcaacactgtaagactgactgagatcaca
gagaaacccccacggtttccagaacagttacccagcgaggtcttgcctgcttccagcgac
acagttcaggaggagcaggagcagaacagtacacactcagtagttaagccctcagaagac
acagaaaatctacatgtcacagagactgctggtaataatctcttacctccagttgatttg
cctgcggaaggcgtggaaaaggaggaggctgctgaaataaggaatccaacttccaacctg
gaatttcgcagacggttttggataagtcgaatcaacagaagtccaattagcaaacgcctt
gatgcaggccagtacctgtttcaagcacccaatcactacatcttccatggggctgaggtt
tactccgactctgaagacgagacatccagctcttgtggcagtgacagcgaggagtcggaa
tgcagcggaagcgggttggaagacaacagtgaacccgaggatgcagacacacgtccagtg
gatgaagaaactcatccaagagacacaattcaacatactgtagccacagcggacgcatcc
agtgtacaaatagacaatacttttgaaaaaattcagaacaccacacacctttaa

DBGET integrated database retrieval system