KEGG   Cynoglossus semilaevis (tongue sole): 103391513
Entry
103391513         CDS       T04866                                 

Definition
(RefSeq) TGF-beta receptor type-2-like
  KO
K04388  TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem04010  MAPK signaling pathway
csem04060  Cytokine-cytokine receptor interaction
csem04068  FoxO signaling pathway
csem04144  Endocytosis
csem04218  Cellular senescence
csem04350  TGF-beta signaling pathway
csem04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:csem00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103391513
   04350 TGF-beta signaling pathway
    103391513
   04068 FoxO signaling pathway
    103391513
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103391513
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    103391513
  09143 Cell growth and death
   04218 Cellular senescence
    103391513
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    103391513
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:csem01001]
    103391513
Enzymes [BR:csem01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     103391513
Protein kinases [BR:csem01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   103391513
SSDB
Motif
Pfam: ecTbetaR2 PK_Tyr_Ser-Thr Pkinase
Other DBs
NCBI-GeneID: 103391513
NCBI-ProteinID: XP_008326019
LinkDB
Position
16
AA seq 575 aa
MKFWFPTLWTWILIFISGGFHKDASSSHLTFNLCKWCESTTPVCQDHVCFTNCSLSSFCT
ASEEICVALWRKTNDTMTVQTMCHLPELPLEGVESGLLQNSTSRECHMIQQQAVNEAMMM
VCGCSGEHECNDQLIFNKRANGFFKLQSKDVVPVVVVSLVPLLLVAALVVTFFYFYRNNC
DHKPRQTSRSDWTAKGAPELYQTLDLLSDGGREGADTHTLPEQSVDTDNISDVNNWQGNL
AEPLHIKLEVLIGKGRFAEVWRACLLQGERDGVSSYETVAVKVFPALEYTSWRNEFLIFT
DPKLKHENVVQFLAAEERGLPGHPHRKYWLVLEYYSFGNLQDFLTANTLSWEELVALAGS
VAKGLAHLHSDMTPSGVPKIPVAHRDLKSSNIVVKSRKECALCDFGLALRLDASLTVDDY
ANSGQVGTARYMAPEVLESRVNLEDLEAFKQMDVYSMALVLWEMASRCQAIGKVESYKPA
FGSKVCEQPCVESMRDLVLRDRGRPEIPPAWTQHPGMNVFCSSITECWDHDPEARLTAHC
VVERLSALQQEEQDWVEQEPQGKTGAETTRQECEI
NT seq 1728 nt   +upstreamnt  +downstreamnt
atgaagttctggttcccgactctttggacctggattctaatctttatcagtggaggcttc
cataaagatgcctcctccagtcacctcacctttaacctgtgtaaatggtgtgaatcaacc
acgcctgtgtgtcaagaccacgtctgcttcactaactgctcattgtcgtccttctgcacc
gccagtgaggagatctgtgtggcgctgtggaggaagactaatgacaccatgacagtccaa
accatgtgccatttgcccgagttgcctttagagggtgtggaatctggtctgctgcaaaac
tccacatccagagaatgccatatgatccagcagcaggcagtgaatgaagccatgatgatg
gtttgtggctgcagtggagagcatgagtgcaatgaccagctcattttcaacaaaagggcc
aatgggtttttcaagctccaaagtaaagacgtggtgccagtggtcgtggtcagtttggta
cccctcctcctagttgcggcccttgttgtcacgttcttctacttctaccgcaacaattgc
gaccataaaccacgccaaacttcacgctcagactggaccgccaaaggcgccccagaactc
taccagacattagacctgctgtctgatggaggaagagaaggagcagacacacatactctg
ccggaacaatcagtggacactgacaatatcagtgacgtcaacaactggcagggaaatctt
gcagaaccactacatattaaactcgaggtgctcattgggaagggtcgattcgcagaagtg
tggcgggcttgcctcctgcagggtgagagagatggagtgagcagttatgaaactgtcgcg
gtaaaggtgttccctgccctggagtacacctcgtggagaaatgaattcttaatcttcaca
gacccaaagctaaagcacgagaatgtggttcagttcctcgcagccgaggaaaggggtctc
cctggtcacccccacaggaagtactggctggttctagaatactacagctttggcaacctc
caagactttctgacagcaaataccctgagctgggaggagcttgttgccttagcggggagt
gttgctaaaggtttagctcacctgcacagtgacatgactcctagtggtgtaccaaagata
cctgtggctcatcgggacctgaagagtagtaacattgtggtgaaaagccggaaggagtgt
gctctctgtgattttggtctggccctgagactggatgcatccctcactgtggatgactat
gcgaacagtggacaggtaggaacagcaagatacatggcacctgaagtactggagtccagg
gtgaaccttgaggatctggaggctttcaaacagatggatgtttattccatggctcttgtt
ttgtgggaaatggcctctcgctgccaggccatcggaaaggtggagagctacaagcccgca
tttggctccaaggtttgtgagcagccttgtgtggagagcatgagagacctggtactgagg
gacagaggacgaccagagattccaccagcatggacgcaacatccaggaatgaatgtcttc
tgttcgtccatcaccgagtgctgggatcatgatccagaagccagactgacagctcactgt
gttgtggagcgtttaagtgctttacaacaggaggagcaggactgggtggagcaggagccg
cagggtaaaacaggtgcagagaccacaagacaggagtgtgaaatctga

DBGET integrated database retrieval system