KEGG   Cynoglossus semilaevis (tongue sole): 103392208
Entry
103392208         CDS       T04866                                 

Gene name
prkacb
Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit beta isoform X1
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem04010  MAPK signaling pathway
csem04020  Calcium signaling pathway
csem04114  Oocyte meiosis
csem04140  Autophagy - animal
csem04261  Adrenergic signaling in cardiomyocytes
csem04270  Vascular smooth muscle contraction
csem04310  Wnt signaling pathway
csem04340  Hedgehog signaling pathway
csem04371  Apelin signaling pathway
csem04530  Tight junction
csem04540  Gap junction
csem04910  Insulin signaling pathway
csem04912  GnRH signaling pathway
csem04914  Progesterone-mediated oocyte maturation
csem04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:csem00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103392208 (prkacb)
   04310 Wnt signaling pathway
    103392208 (prkacb)
   04340 Hedgehog signaling pathway
    103392208 (prkacb)
   04371 Apelin signaling pathway
    103392208 (prkacb)
   04020 Calcium signaling pathway
    103392208 (prkacb)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103392208 (prkacb)
  09143 Cell growth and death
   04114 Oocyte meiosis
    103392208 (prkacb)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    103392208 (prkacb)
   04540 Gap junction
    103392208 (prkacb)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    103392208 (prkacb)
   04912 GnRH signaling pathway
    103392208 (prkacb)
   04914 Progesterone-mediated oocyte maturation
    103392208 (prkacb)
   04916 Melanogenesis
    103392208 (prkacb)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103392208 (prkacb)
   04270 Vascular smooth muscle contraction
    103392208 (prkacb)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:csem01001]
    103392208 (prkacb)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:csem03019]
    103392208 (prkacb)
   03036 Chromosome and associated proteins [BR:csem03036]
    103392208 (prkacb)
Enzymes [BR:csem01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     103392208 (prkacb)
Protein kinases [BR:csem01001]
 Serine/threonine kinases: AGC group
  PKA family
   103392208 (prkacb)
Messenger RNA biogenesis [BR:csem03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     103392208 (prkacb)
Chromosome and associated proteins [BR:csem03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    103392208 (prkacb)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like
Other DBs
NCBI-GeneID: 103392208
NCBI-ProteinID: XP_008326994
LinkDB
Position
2
AA seq 447 aa
MSQESSLMSETDTEYLNRKLNFLWLAEHLLCTLLHTGSCKCHSLLTAHCLKHLLGLRATH
VKEFVSKMAQGKEQSFASRLFQKYCKGSQEQRGQESDVPHISEFTLMWDKSMKEFLAKAK
DDFLRKWDCPQQSTTGLDDFDRFKTLGTGSFGRVMLVKHKGTNQFYAMKFLDKQKVVKLK
QIEHTLNEKRILQAVSFPFLVRLEYAFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEHHA
RFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQHGYIQVTDFGFAKRVKGRTWTLCGTPE
YLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSS
DLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFSTTDWIAIYERKVEAPFMPKCRGPGD
TSNFDDYEEEEIRVSQTEKCAKEFADF
NT seq 1344 nt   +upstreamnt  +downstreamnt
atgtcacaagaaagtagtctcatgtcagagactgacactgagtacttgaacaggaagctc
aactttctgtggttagctgagcatttgctgtgcactttgctgcatacaggaagctgcaag
tgtcactcactgctgactgctcactgcctgaaacatttgctcggtctgagagcaacacac
gtcaaagaatttgtgtcaaagatggctcagggaaaggagcaatccttcgccagccgttta
tttcagaagtattgcaaaggcagccaagagcagagaggacaggaaagtgatgtgcctcac
atctctgagttcactctcatgtgggacaagtccatgaaagagttcttagctaaagccaaa
gacgactttttaagaaaatgggactgtccacaacagagcacaactggcctagacgacttt
gacagatttaagacgttggggacgggctcattcgggcgagtgatgcttgtcaaacataaa
ggaacaaaccagttttatgccatgaagtttttggacaaacaaaaagtggttaaactaaag
cagatagaacacacactaaatgaaaaaagaatactacaggccgtctccttccccttcctc
gtcagattggagtacgctttcaaggacaactcaaacctttacatggtgatggaatatgtc
cccggtggagagatgttctcacatctcagacgtattggcaggttcagtgaacatcatgca
agattttatgcagctcagatagtgctcacctttgagtaccttcactctttagacctcatc
tacagagacttgaagccagaaaacctactcatagatcagcatgggtatattcaggtcaca
gattttggatttgccaaaagagtcaaaggcaggacctggacgttgtgtggaactcccgag
tatctggctccagagataatcctcagcaagggctacaacaaagctgtggattggtgggca
cttggagttctaatctacgaaatggctgctggttatcctcccttttttgccgaccagccg
atccagatctacgaaaagattgtgtccggcaaggtacgattcccctctcactttagctct
gaccttaaagacctgctgagaaatctgctgcaggttgacctgaccaagagatttggcaac
ttgaagaatggtgtgaacgacataaaaaatcacaagtggttctccacaacagactggatt
gccatatatgagaggaaggtggaagctccctttatgccaaagtgcagaggtccaggagat
acgagcaactttgacgactacgaagaggaggaaattcgagtgtcgcaaacggaaaagtgt
gcaaaagagtttgctgatttctag

KEGG   Cynoglossus semilaevis (tongue sole): 103392719
Entry
103392719         CDS       T04866                                 

Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit alpha isoform X1
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem04010  MAPK signaling pathway
csem04020  Calcium signaling pathway
csem04114  Oocyte meiosis
csem04140  Autophagy - animal
csem04261  Adrenergic signaling in cardiomyocytes
csem04270  Vascular smooth muscle contraction
csem04310  Wnt signaling pathway
csem04340  Hedgehog signaling pathway
csem04371  Apelin signaling pathway
csem04530  Tight junction
csem04540  Gap junction
csem04910  Insulin signaling pathway
csem04912  GnRH signaling pathway
csem04914  Progesterone-mediated oocyte maturation
csem04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:csem00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103392719
   04310 Wnt signaling pathway
    103392719
   04340 Hedgehog signaling pathway
    103392719
   04371 Apelin signaling pathway
    103392719
   04020 Calcium signaling pathway
    103392719
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103392719
  09143 Cell growth and death
   04114 Oocyte meiosis
    103392719
  09144 Cellular community - eukaryotes
   04530 Tight junction
    103392719
   04540 Gap junction
    103392719
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    103392719
   04912 GnRH signaling pathway
    103392719
   04914 Progesterone-mediated oocyte maturation
    103392719
   04916 Melanogenesis
    103392719
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103392719
   04270 Vascular smooth muscle contraction
    103392719
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:csem01001]
    103392719
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:csem03019]
    103392719
   03036 Chromosome and associated proteins [BR:csem03036]
    103392719
Enzymes [BR:csem01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     103392719
Protein kinases [BR:csem01001]
 Serine/threonine kinases: AGC group
  PKA family
   103392719
Messenger RNA biogenesis [BR:csem03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     103392719
Chromosome and associated proteins [BR:csem03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    103392719
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like HrpJ
Other DBs
NCBI-GeneID: 103392719
NCBI-ProteinID: XP_008327635
LinkDB
Position
17
AA seq 377 aa
MCDRKSSRRHAGKRDSSSRSSESSSRTAEAAAEEMLTVVPSVKEFLAKAKEDFLKKWENP
AQQTAGLDHFERLKTLGTGSFGRVMLVKHKETGQHFAMKILDKQKVVKLKQIEHTLNEKR
ILQAVSFPFLVRLEHSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLT
FEYLHSLDLIYRDLKPENLLIDHQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSK
GYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLL
QVDLTKRFGNLRNGVNDIKGHKWFATTDWIAIYQRKVEAPFIPKCKGPGDTSNFDDYEEE
EIRVSFTEKCAKEFAEF
NT seq 1134 nt   +upstreamnt  +downstreamnt
atgtgtgacaggaagagctcaagaaggcatgcagggaagagggactcatcctcacgctcg
agtgaaagcagttcacgcacggcagaagctgcggcagaagagatgctcacagtcgttcca
agtgtaaaggagtttcttgccaaggccaaagaagacttcttgaagaaatgggagaatcca
gcacagcaaactgcaggattggatcactttgagcggttgaagactttaggcactggttcc
tttggtcgagtcatgttggtgaaacacaaagagacgggccagcattttgccatgaaaata
cttgacaagcagaaggtagtgaagctgaaacaaatagagcacacgctgaatgagaaacgc
atcctgcaagctgtcagctttcccttcctggttcgcctggagcactcctttaaggacaac
agtaacctgtacatggtgatggagtatgtaccaggaggtgaaatgttctcgcacttaagg
agaatcggtagattcagtgaaccacacgctcgcttttacgcagcccagattgttctgacc
tttgaatatcttcactcgctggatctcatctaccgagatctgaagccagaaaacctgctc
attgaccaccaaggttacatacaggtcacagattttggatttgcgaaacgggtgaagggt
cgaacatggacgctttgtgggactccagaatacctggcaccggagatcattctcagtaag
ggttacaataaggcggtggactggtgggccctgggtgtgctgatatacgagatggctgca
ggttatcctcctttctttgcagaccagcccattcaaatctacgagaagatcgtatcaggg
aaggttcgcttcccctcccacttcagttcggacctgaaggatctgctaagaaatctgctt
caggtggatctgaccaagcgttttggtaacctcaggaatggagtcaacgacatcaagggc
cacaagtggttcgccaccactgactggatcgccatctaccagagaaaggtggaagctccc
tttattcccaagtgcaaaggccccggtgacacgagcaacttcgacgactacgaggaagaa
gaaatcagagtctccttcacagagaagtgtgcaaaggagtttgctgaattctag

KEGG   Cynoglossus semilaevis (tongue sole): 103396312
Entry
103396312         CDS       T04866                                 

Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit beta isoform X1
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem04010  MAPK signaling pathway
csem04020  Calcium signaling pathway
csem04114  Oocyte meiosis
csem04140  Autophagy - animal
csem04261  Adrenergic signaling in cardiomyocytes
csem04270  Vascular smooth muscle contraction
csem04310  Wnt signaling pathway
csem04340  Hedgehog signaling pathway
csem04371  Apelin signaling pathway
csem04530  Tight junction
csem04540  Gap junction
csem04910  Insulin signaling pathway
csem04912  GnRH signaling pathway
csem04914  Progesterone-mediated oocyte maturation
csem04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:csem00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103396312
   04310 Wnt signaling pathway
    103396312
   04340 Hedgehog signaling pathway
    103396312
   04371 Apelin signaling pathway
    103396312
   04020 Calcium signaling pathway
    103396312
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103396312
  09143 Cell growth and death
   04114 Oocyte meiosis
    103396312
  09144 Cellular community - eukaryotes
   04530 Tight junction
    103396312
   04540 Gap junction
    103396312
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    103396312
   04912 GnRH signaling pathway
    103396312
   04914 Progesterone-mediated oocyte maturation
    103396312
   04916 Melanogenesis
    103396312
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103396312
   04270 Vascular smooth muscle contraction
    103396312
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:csem01001]
    103396312
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:csem03019]
    103396312
   03036 Chromosome and associated proteins [BR:csem03036]
    103396312
Enzymes [BR:csem01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     103396312
Protein kinases [BR:csem01001]
 Serine/threonine kinases: AGC group
  PKA family
   103396312
Messenger RNA biogenesis [BR:csem03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     103396312
Chromosome and associated proteins [BR:csem03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    103396312
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like
Other DBs
NCBI-GeneID: 103396312
NCBI-ProteinID: XP_008332566
LinkDB
Position
20
AA seq 354 aa
MGNAATAKKGNELESETFVKEFLAKAKEDFLRKWECPPQSTTCLDDFDRLKTLGTGSFGR
VMLVKHKGTEQYFAMKILDKQKVVKLKQIEHTLNEKRILQAVSFPFLVKLEYAFKDNSNL
YMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDH
HGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYP
PFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRYGNLKNGVNDIKGHKW
FATTDWIAIYERKVEAPFIPKCRGPGDTSNFDDYEEEEIRVSVTEKCAKEFAEF
NT seq 1065 nt   +upstreamnt  +downstreamnt
atggggaacgcagccacagcaaagaagggcaacgagctagagagcgagacttttgtgaaa
gagtttctagccaaagccaaagaagatttcttacggaaatgggaatgtccaccacagagc
acaacgtgcctagatgactttgacagattaaagacactgggtaccggctcatttggaaga
gtgatgctggtgaaacacaaaggaacagagcaatactttgccatgaaaatactggataag
cagaaggtggtgaaactcaagcaaatagaacatacattaaatgagaagaggatattacag
gcagtgagcttcccctttcttgtcaaacttgagtacgcattcaaggacaactccaatttg
tacatggtgatggagtatgttcctggcggagagatgttttcacacctaagacgaattgga
aggttcagtgaaccacatgcaagattttatgctgctcaaatagtgctgacgtttgagtac
ctccattcactagatctcatatacagagatctgaaacctgagaaccttctcatcgatcat
cacggctacatccaggtgacagacttcggatttgccaagagggtaaaaggcaggacttgg
acattgtgtgggacaccggagtacctggcacctgaaatcatcctcagcaaaggctacaac
aaagctgtggactggtgggccctgggagttctcatctatgaaatggcagctggttatccc
ccgttctttgcagaccaaccgattcaaatatacgagaagatagtgtccggaaaggtccgg
ttcccttcccacttcagctctgacttgaaggatctgctgagaaacctgctgcaggtggat
ctgaccaaacgctacggcaacctgaagaacggtgtcaatgacattaaagggcacaagtgg
ttcgccacaacagactggatcgcaatctacgagagaaaggtggaagcccctttcatacca
aagtgcagaggcccaggggacaccagcaactttgacgactacgaagaagaggagatccgt
gtttccgtaacagaaaaatgtgctaaagagtttgcagagttttag

DBGET integrated database retrieval system