KEGG   Cynoglossus semilaevis (tongue sole): 103392614Help
Entry
103392614         CDS       T04866                                 

Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 14-like isoform X2
  KO
K04466  mitogen-activated protein kinase kinase kinase 14 [EC:2.7.11.25]
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem04010  MAPK signaling pathway
csem04210  Apoptosis
csem04625  C-type lectin receptor signaling pathway
csem04672  Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:csem00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103392614
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    103392614
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    103392614
   04672 Intestinal immune network for IgA production
    103392614
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:csem01001]
    103392614
Enzymes [BR:csem01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     103392614
Protein kinases [BR:csem01001]
 Serine/threonine kinases: STE group
  Other
   103392614
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal Kinase-like SH3_11
Motif
Other DBs
NCBI-GeneID: 103392614
NCBI-ProteinID: XP_008327482
LinkDB All DBs
Position
17
AA seq 858 aa AA seqDB search
MAVRQRIFNSTAPFSGSPKTELKGSYPKCTAAEQETEDEEEEGKDSKMGFTHLSPLLNKL
LTHGTAEQVGEMPLKTSTFIAQAECETQDSQEFSPSCFKRSFVPSPNCFTSSLSSEHNNV
ASPTTASGKELGNSSLHLKPRKKNRKRQKSRGKKRLDKNEKQPHRQRTPSGVPEQESGRS
AIQILEPSSSLGGRSNLCTPGCSSNENSEEQHRGPSLYTGQIYNTSSSHSLLNWGSQVHG
PLSGLQSLGQDTESDSDFLSSLGDCSLALAGLRGSVSQGDPCYAGPFFKAVERDVREEDD
EVSAEDSFSNEGIIFYNDKIKPVDSEYREGRELMLTNFIKQGSYGEVYGAQDVNTGFRFA
VKKIALKRFTSEEVGAWSTLRSPHVLELFGVVREGPNVLLLMDHKSGSVGQLISERGRLP
EDLSLHYHFQVLTALEYLVKKKVVHLDIKADNVLLSEDGRHTFLCDFGHAERLDNQGRSL
SVSNDLKGTETHMSPEIVKGKPRGPKADVWSSCCMLLHMLNGCQPWTRYYTCRLYLKIAD
EPPPLREIPPDCGSLTAEVLKAGLQKDPVKRASASDLKAKTDRALKDVGGLTSSAKGPYT
EPLYITGKPPSSLQLNHSSIDCDEEEEQPKNLIVAEKETKGGHQEEAGTEASKRSSKNCP
QSPIYEPNHKRNNRTTTVSELELRKLERDFYLSSLSQPQSAEMQVQLLSCLGSEAYSNWE
PWDKKDSGWWSLSPGDDFSSGVFSYNSQPDVQVFSMDLLGHTQLPPPCCFEGVDVCIRDF
CKRSIRIRETRRVKVGHIATGISDQISERVFTLETQQGQQVAHDEEVLESGLELCCVPAP
DYSPVWRWRVRDGALETR
NT seq 2577 nt NT seq  +upstreamnt  +downstreamnt
atggcggtgaggcagaggattttcaactccacagctccgttctccggctcgcctaagacg
gagctgaagggctcttacccgaaatgcaccgccgccgaacaggagacggaggacgaagag
gaagagggaaaggacagcaaaatgggcttcactcatttgagtcctttgctaaataaactc
ttgacgcatggaaccgcagagcaggtcggcgaaatgccactgaagacctcgaccttcatc
gctcaggctgaatgtgaaacccaggattcccaggagttcagtccatcctgtttcaaacga
tcttttgttccctctcctaactgcttcaccagcagcctgtcctcagaacacaacaatgta
gccagtccgacaacagcctctgggaaggagctgggcaactcatcgctgcatctcaaaccg
aggaaaaagaacaggaagagacaaaagagtagagggaaaaaaaggctggacaaaaatgag
aagcagccacacagacagcgaacgccttctggtgtccctgaacaggagagtggaagatct
gccatccagatccttgagccttcatcatctctcggagggaggagcaatctttgcaccccc
ggctgtagcagcaatgaaaactccgaggagcagcaccgagggccttctctgtatacgggg
cagatttacaacacaagctccagtcactctcttttgaactgggggagccaggtgcacggc
cccctttccggtcttcagtccttagggcaggacaccgaatcggactccgacttcctcagc
agtctaggagactgttctctggccctcgctggcctgaggggcagcgtgagtcagggggac
ccttgctatgcagggccctttttcaaagctgtggagagagacgtgagagaggaggacgac
gaggtctccgccgaggattctttcagcaacgaagggatcatcttttacaacgataaaatt
aaacctgtggactccgagtacagggaaggaagagagttaatgctcacaaacttcataaaa
caaggctcgtacggggaagtgtacggtgctcaagatgtcaacacaggcttcagatttgct
gtcaaaaagatcgctttgaagaggttcaccagtgaggaggtgggtgcgtggagtaccctc
agatctcctcatgttctggagctctttggagtggtcagagaagggccaaatgttctgctc
ctaatggaccacaaatccggctctgtgggtcagctcatcagcgagcgcggccgactgccg
gaggatttgagtctccactaccactttcaagttttaacagcgctggaatacttggtgaag
aaaaaagtagtgcaccttgatattaaagctgacaatgtgttgctgtcggaggacggtaga
cacacatttctgtgtgactttggacatgcagagagactggacaaccaaggacggagcctt
agtgtgtccaacgatctaaagggcaccgagacccacatgtctcctgagattgttaaagga
aaaccccgcggacccaaagcagatgtgtggagcagctgctgtatgttactgcacatgctc
aatggctgtcagccatggacaagatactacacctgtcgactttacctgaagatcgctgac
gagcctccgcctttgagggagatcccaccagattgtggttctctcacagcggaagttctc
aaggcaggactgcagaaggatccggttaagagagcgtcggcatcagatctcaaagcaaag
acagacagagctttgaaagatgttggaggtttgaccagctcagcaaagggaccctacact
gaacccctgtacatcacaggcaagccaccctcttctctgcaacttaatcacagcagcatt
gactgtgatgaggaggaggaacagccaaagaatctgatcgtagctgaaaaggagacaaag
ggaggacaccaagaagaagcagggacagaggcgtcgaagagaagctcgaaaaactgtccg
cagtctcccatctacgagccaaaccataaaagaaacaaccgaaccaccactgtgtccgaa
ctggagctgcgtaaactggagcgagacttctacctgagcagtctgtcccagcctcagtct
gcggagatgcaggtgcagctgctgtcctgtctcggcagtgaagcatattcaaattgggag
ccgtgggacaaaaaggactctggctggtggtccttgagtccaggagacgacttcagctct
ggtgtcttctcctacaacagtcagcctgacgtgcaggtcttcagtatggacctgctgggt
cacacacagttaccgccaccctgctgtttcgaaggtgtggacgtctgcatcagagacttc
tgtaagaggagcatcaggatcagagagacacggcgggtgaaggtgggccacatcgctact
gggatcagtgatcagatctccgagagagtcttcactctggagacacagcagggacagcag
gtggctcacgacgaagaagtgctggagtctggtctggagctctgctgtgttcctgctccg
gactacagccccgtgtggaggtggagggtcagagatggagcgttggagacgagatag

DBGET integrated database retrieval system