KEGG   Cynoglossus semilaevis (tongue sole): 103392691Help
Entry
103392691         CDS       T04866                                 

Definition
(RefSeq) uncharacterized protein LOC103392691 isoform X1
  KO
K11429  histone-lysine N-methyltransferase SUV420H [EC:2.1.1.43]
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:csem00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    103392691
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:csem03036]
    103392691
Enzymes [BR:csem01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     103392691
Chromosome and associated proteins [BR:csem03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     103392691
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET
Motif
Other DBs
NCBI-GeneID: 103392691
NCBI-ProteinID: XP_008327598
UniProt: A0A3P8VGN6
LinkDB All DBs
Position
17
AA seq 2038 aa AA seqDB search
MDGCTRMSVKELCETDDLATRLVLDPLLGFSTHKMNISPPPEIRRWGNLKETLLRFQRTH
DFDTTFEALTEGELAGDYFNALGSHRQELLRQHVYRYLSAFLLDSGVKIESCDRYSSETN
GAKITSSRHWFAGERVEVLLGCIAELSPTDSAVLRAGVNDFSVMYSTRKRCAQLWLGPAA
FINHDCKPNCKFIPGEKNVACVEVIRPISPGEEITCYYGASFFGEGNEMCECCTCERNGE
GHFKHKGKQPECEETKDPIGQKYRLRERYLRHHREKGHFPARPLIPRSHSGIFKAIPSRN
SFTQQMRRNALKSRKLSQQKQWQLEKHRRSGKHTFKLNTVKQRRTITLLSKVTLKELSIR
VRHHSVDFLINCKDPNSKERALLQKLEEAKRNDKKPSELTSCSDRNSSKVNLKPFNQNCV
AFNQKSKKVVNRVDPSRRSVRVITMAHSKTTSSTRKNVQTELKEQRESCNGDKMAPLCPP
VKSNDAGAIKQEMIESHDQKCRSTECCDAIAVQGPDTEETLQNNNQTPSQVKVCGDNPLK
SIKQYLTINLWRVALPQCVELEKATEDRPAKVELRTRSKQSQCPRPAPLTIQTKRASRAQ
QNQDGRAGICTAEGNKGVREMLFKAVDKVNVRNGHANETTGESCQAEKKMSEKVIEIQTL
PKDEKTSLQSTQPGVSKGKPEEGKKQEKDAPKVRNDETNGAHEDMIESESAGVSNKESPN
QNLTESVNTKDKDLGTEKGLAIESSKDKQEAPQPKCIDINGAKVVLFDILKNKNLKENIL
KRLTSQALECVQRFKEQEQIETNKGQNNLVLRHDLNRRNLRSRMAKTKMGNECGTRAHLS
KDVSAESKTGFGEDDLHPHLSPKHIAPTDTIPSPLPQKYSVTAKVSNNMFPDNPQTHIQS
NIPLKKRTFRSDVELDSKQGLNPSSQADKKLQDNSSAALSQEPTCGSGESKSNKLKFHKV
TQNRIPKQNAVKRVLRPRATIVKRVCSRNLRGSNVEADDGASDKDQTQNQLAEENQRSPA
EFNKHSSKAELHQSPQKIKKKHEEVETLCQESDVEETKPSLNFKIRFKRRKGKLWEMQSG
FFENMLLKREKKDEAGTCDPFKAIMDSVSVLNMEMEAARAHVKASKKSKNKFLLLKRRGN
RFHKKRIKSSYTKLVKGQGLNETSELTIEGPKKRKSDLEVVGQDTLNSEYQKINRQTPSG
AVQNTKVEGCFANNCCMFENGSQQKQEPEFNANGLLLPVIKLRRKEEDIWEVDSLEVFPT
EPIGGSVLKKEMGNHVLGKQKKEHLESCKLSKECSSTQRVNNNGSMKTEPLPFSLSLSPL
SLSSPLGDNRSDISSAAANKIIERPEFNGSGKKHRAKMERMRKSGPVETSTTCLSHSLQQ
IDNSLSRLSEGLCSSQTLEKPPSSLNLSSSVIQPVSQFTSFPTAENMLSGEPSFSNCCDD
ILDFQYLNFEGYYQPQNILPSSPSDLLDPPTDPFSSPLSHSPSDTWTAETPYLGPPSPET
NFTSEDLPFFPGLISTKGDPVSSDCEGRDLSTNRILPSFSSLSNSDLTAKTLSVGRAPRI
RPSKEDLKSQPFSVVNKPRLFGTTSHSATSHNPVSITQPSVHVKPNISQPKPQTNLKSQG
PFHRVAIPSKSQSFFSHSHPNTAKGVPQSCLTKTVPSSIMPSKLLSTQFSNVKKTNLSEN
PFNFHEKNPTVIHRVLKYQGGSQSQNLYSAPCKDTTAAGSPNILSTTRGTKSDSIEKPHQ
TQKLDPRVASHHKGTFSFQGFGKDVAHVFSSARAIPHLGKTNSPFTQSSSKPRMAFDKPE
SGEPNMAYRNFSTLTRPFLFPNKATESLPLPQDKSLKVDKSTILSSDKHQPCFAQTDQFD
FSFNSSLSPMSQHNSSQIIPNTAPNTPAPANKSHPSTASTAFPYGYQGPPYVLNFSGDHS
LTLGLRDGADGYPGLGSTNYTYHCLMEPSGTQGRLVLEPCGTQLSNPPSFSLGSFSGLKG
QEDHSRKDGQQQCQSGESHGPPHYGPGTTSHSVGATKPKRVRLVVTDGTVDLDLQYSD
NT seq 6117 nt NT seq  +upstreamnt  +downstreamnt
atggacggatgcactagaatgagtgtaaaggagctgtgtgagaccgatgacctggctacc
cgtctggtgctggaccctttactggggttcagcacacataaaatgaacatcagcccccca
ccagagatcagacgatggggtaacctcaaagagaccctgctgcgctttcagcgcacacat
gattttgacactacgtttgaggccttgactgaaggtgaactggctggtgactacttcaat
gctttgggaagccatcgacaggaactacttagacaacatgtgtaccgctacctcagtgcc
ttcctgctggatagtggagtgaaaatcgagtcctgtgacagatattcttcagagaccaat
ggagcgaagataacttcatcaaggcactggtttgcaggagagcgggtggaggtcctgctg
ggctgcatagcagagctgagccccactgacagtgctgtgctgagagcgggagtcaatgac
ttcagcgtgatgtattctacacgcaaacgctgtgcacagctctggcttggacctgcagct
ttcattaaccatgactgcaaacccaactgcaagttcatccctggtgagaagaacgttgct
tgtgttgaagtgattcgtcctatatcaccaggggaggagatcacgtgttactacggtgcc
agcttttttggcgaaggcaatgaaatgtgtgaatgctgcacctgtgagagaaacggagaa
ggtcacttcaaacacaaagggaagcagcctgaatgtgaagaaacaaaggaccctattggc
caaaagtaccgactgagggagcgatatcttcgccatcaccgggagaagggccattttcct
gcgagaccactaataccacgatcacactcaggtatctttaaagccatcccctcaaggaat
tccttcacccagcaaatgagaagaaatgccttgaagagcagaaaactgagtcaacaaaag
caatggcaactagagaaacacagacggtcaggcaagcacacatttaagctcaacacagtc
aaacagcgaaggacaattacacttctgtccaaggttacactgaaggaactcagcatcaga
gtacgacaccactctgttgattttctgatcaactgtaaggatcccaatagcaaagaaaga
gccctgctgcagaaactggaggaagcgaagaggaatgataaaaaaccaagtgaattgact
tcctgtagtgatagaaacagcagcaaggtcaacttaaagcctttcaatcagaattgtgtc
gcatttaatcaaaaaagtaaaaaagtagttaatagagttgatcctagtagaaggtcagtc
agagtgataacaatggctcactccaagaccacttcaagtacaagaaagaatgttcaaact
gagctcaaagagcaacgggagtcatgtaatggggacaaaatggcacctctttgtccccct
gttaagagcaatgatgctggtgcaataaagcaagagatgattgaaagtcacgaccagaag
tgcagaagcactgaatgctgtgatgctattgcagttcaaggcccagacacagaggaaacc
ttgcagaacaacaaccaaacaccatcccaagtaaaagtttgtggagacaaccctttaaaa
tcaattaagcaataccttacaataaacctatggagagtggcattgccacagtgtgtagag
ttagaaaaagcaaccgaagacaggccagcaaaagtggagttaagaacaagaagcaagcag
agccagtgtccaagaccagcacctctgacaatccagacaaaaagagcgtccagggctcaa
cagaatcaagatgggcgagcagggatctgcacagctgaaggcaacaaaggggtgagggaa
atgttatttaaggctgttgataaagtaaatgtgaggaatggacatgcaaatgaaaccaca
ggtgaatcatgccaggctgagaaaaagatgagtgaaaaagtaattgaaattcaaacattg
ccaaaggatgaaaaaacaagcttgcaaagcacacagcctggagtgtcaaaaggcaaacct
gaagagggcaaaaaacaggaaaaagatgcacctaaagttaggaatgatgaaaccaatgga
gcccacgaagatatgattgagtctgaaagtgcaggtgtctctaacaaggaaagtcctaat
cagaatttaactgagagtgtgaacactaaagacaaggatttgggtacagagaaaggactt
gcaatagagagtagcaaagacaaacaggaggcacctcaaccaaagtgtattgacattaat
ggtgcaaaagttgttctttttgatatattaaaaaataaaaacttaaaagaaaacatttta
aaaaggcttacttctcaagctttagaatgtgtgcaaagattcaaggagcaagaacagata
gaaacaaataaaggccagaacaatctagtgttgaggcatgatctaaacagacgaaattta
agatctagaatggcaaaaacaaaaatggggaatgaatgtggcaccagggcacacctgagc
aaagatgtttcagctgaaagtaagactgggtttggggaggatgatttgcatccccacttg
tctccgaagcatattgcccctacggacaccatcccaagtccactacctcaaaaatactca
gtgacagcaaaggtttcaaataatatgttcccagacaatccacagacacacatacagtcc
aacataccactgaagaaacgtacatttcgaagcgatgtggagttggactcaaaacaaggc
ttgaacccttcaagtcaagctgataagaaattgcaggacaattcctctgcagcactaagc
caggaacctacctgtggttcaggggaaagtaagagtaacaaactgaaattccacaaggtt
acccaaaacagaataccaaaacaaaatgctgttaaaagagtgctacgccccagagccacc
atagttaagcgagtctgttcaagaaacctccgagggtcaaatgttgaagcagatgatggc
gcttctgacaaagatcagacacaaaatcagttggcagaggaaaaccaaaggagtccagca
gaatttaacaagcattcaagcaaagccgaactccatcaatccccacaaaaaataaaaaaa
aagcatgaagaagtggaaacgttatgtcaagaaagtgatgtggaagagacaaaacctagt
cttaattttaagatccgatttaaaagaaggaaaggtaaattatgggaaatgcaaagtggt
ttttttgaaaatatgttattgaaaagggaaaaaaaagacgaggcagggacatgtgatcca
tttaaagccattatggactctgtatcagttttaaacatggagatggaggcagcgcgtgct
catgtgaaggcgagtaagaagtcaaagaacaaatttctccttttaaaaagaagaggtaac
aggtttcataaaaagcgcattaagtcctcttacacaaaactagtgaaaggtcaaggtctt
aatgaaaccagtgaattaaccattgagggtccaaaaaaacggaagtctgatttggaggtt
gtaggtcaggacacacttaactctgagtatcagaaaattaacaggcagactccgtcaggt
gctgttcaaaacacaaaggttgaaggttgttttgcaaacaattgttgcatgtttgaaaat
gggtcacaacagaagcaggagccagaatttaatgcaaatggtcttttgttaccagtaatt
aaattgcgtaggaaagaggaagatatttgggaagtggacagcctagaggtctttccaaca
gaacctataggaggttctgttcttaagaaagaaatgggaaatcatgttttaggaaaacaa
aagaaagagcatttggagtcatgtaagctcagcaaagagtgttcttccactcagagggta
aacaacaatggctctatgaaaactgaaccactgccattctctttatcactgtcaccactg
tctctttcttctcctcttggcgacaataggtctgacatttcatccgcagctgccaataaa
attattgaaaggccagagtttaatggtagtggaaagaagcacagggccaaaatggaaagg
atgcgaaagtctgggcctgtagagacatccaccacttgtttaagtcactctcttcaacag
attgacaacagtctgtctagactatctgaaggtctgtgttcatctcagactcttgaaaag
cctccgtccagtttaaatctttccagttctgtcattcagccagtctcccagtttacgtcc
ttccccacggcagaaaacatgctttccggtgagccaagcttctcaaattgctgtgatgac
attttggactttcagtatctcaactttgagggctattaccagccacagaacatcctccca
tcttcaccctcagatctgctggatccacccacagatcctttcagcagtcccctctctcat
agcccatcagatacatggactgctgagacaccctaccttggtcctcccagtccagaaacc
aacttcaccagtgaagatctcccgttttttcctggtctaatatctactaaaggtgaccct
gtttcttcagattgtgaaggaagggatttgtccaccaacagaatccttcctagcttttca
tctttaagcaactctgacttaactgctaaaaccctcagtgtgggtagagctccaagaatt
aggccatccaaagaggacctcaagagtcagccattctctgttgtcaacaagcctcggttg
tttggtaccacctcgcattctgccacgtcacataatcctgtcagtataacgcagccttca
gttcatgtcaaacccaacatcagccaacctaaacctcagaccaacttaaaaagccagggc
cctttccatcgtgtggcaatacccagcaaatctcagtctttctttagccacagtcaccct
aacactgctaaaggagtgccccagagttgcctaacaaagacagttccatcatctataatg
ccttctaaactcctctctactcagttttctaatgttaaaaaaacaaatctttcagaaaac
ccatttaacttccatgaaaaaaatcctaccgttattcacagggtgcttaagtatcaggga
ggcagccagagtcagaacttgtacagtgcaccttgtaaagacaccacagctgcaggcagc
cccaatattctttccacaacccgtggtactaaatcagactctattgagaaaccccaccag
actcagaaacttgatccccgtgtagccagccatcataaaggtacattttcatttcaggga
tttggaaaagatgttgcccatgttttttcatctgccagggccatccctcatcttggcaaa
accaactcaccttttacacagtcttctagtaaacctaggatggcatttgataaaccggaa
agtggagaacccaacatggcctacagaaacttctctacgctgacaagaccgttccttttt
cctaacaaagcaactgaaagtctaccattgccacaggacaagagtttaaaagtagacaaa
tcaaccattttatcttcagacaaacaccagccctgttttgctcagacagatcagtttgat
tttagcttcaactcctctctttcgcccatgtcacagcacaatagttctcaaattatcccc
aatacagctcctaatacgccagcaccagcaaacaagagccatccctcaacagcctcaaca
gctttcccctacggctaccaaggacctccttatgtactgaattttagtggcgatcattca
ttgactctgggtctcagggatggtgctgacggttatcctggactgggctcaacaaactac
acctaccattgcctgatggaaccttcaggcacacaaggacgattggttcttgagccctgt
gggactcagctttcaaacccaccgtctttttccctgggtagtttttccgggctgaaaggt
caggaggaccacagcaggaaagatggacagcagcaatgccagtctggagaatcccatggc
ccaccacactacggacctggtacaacatctcactcagtgggggccacaaaacccaaacga
gtgaggctggtggtgacagacggtacagtagacttggatctccaatactctgactga

DBGET integrated database retrieval system