KEGG   Cynoglossus semilaevis (tongue sole): 103392851Help
Entry
103392851         CDS       T04866                                 

Definition
(RefSeq) procollagen galactosyltransferase 1-like
  KO
K11703  collagen beta-1,O-galactosyltransferase [EC:2.4.1.50]
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem00310  Lysine degradation
csem00514  Other types of O-glycan biosynthesis
csem01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csem00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    103392851
  09107 Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    103392851
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:csem01003]
    103392851
Enzymes [BR:csem01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.50  procollagen galactosyltransferase
     103392851
Glycosyltransferases [BR:csem01003]
 O-Glycan biosynthesis
  O-linked Gal type
   103392851
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_25 Glyco_tranf_2_4 Anp1
Motif
Other DBs
NCBI-GeneID: 103392851
NCBI-ProteinID: XP_008327816
UniProt: A0A3P8VVW3
LinkDB All DBs
Position
17
AA seq 613 aa AA seqDB search
MFCPNLACLSTPLLLWLLSWCCSPAYGYFAEERWCPESQLQAPRLFLALICRNSAHSLPY
FLGTIERLNYPKDRMALWVATDHNEDNTTTILRDWLSTVQTLYHYVEWRPKEVPSRYPDE
DGPKQWTDLRYEHVMKLRQVALESAREMWADYFMLADCDNLLTNPDVLWKMMKENKTIIA
PMLESRAAYSNFWCGMTSQGYYKRTPAYIPIRKQVRKGCFAVPMVHSTFLIDLRKEASKQ
LAFHPPHPEYTWAFDDIIVFAYSAQMADVQMFVCNKETYGYLPAPLRSHNTLQDEADSFL
HTVLEVNVRNSALTPSKHVRVPRRKPDKMGFDEVFMINLQRRTDRKERMLRTLYQQEIAC
KVIAAVDGKAMNISEVQAMGIHMLPGYSDPYHGRPLTKGELGCFLSHYKIWEEIVERQLH
TSLVIEDDLRFEVFFKRRLMNLMYEVEEEGLDWDLIYIGRKRMQVDHPEKAVPNVHNLVE
ADYSYWTLGYMISLQGAEKLLKAEPLKRILPVDEFLPIMYNKHPVSDYMEQFETRDLKAF
SAEPLLVYPTHYTGDPGYISDTETSTVWDNDKVRTDWDRARSGKTQEQAKISSEAQNSDV
LQSPWNSAARDEL
NT seq 1842 nt NT seq  +upstreamnt  +downstreamnt
atgttctgccctaacttggcctgcctctccaccccgctgctgctctggctgctctcctgg
tgctgctcccctgcctacggatacttcgcagaggagcgatggtgcccggagtctcagctc
caagctccgcggcttttcctcgctctcatctgcagaaactccgctcactcgctgccctat
tttctcggcaccattgagcgactcaactaccccaaggatcgcatggctctatgggtagcg
actgatcataatgaggacaacactacaaccatcctgcgagactggctttccaccgtgcag
actctttatcattatgtggaatggaggccaaaagaagtgcccagtcgctatccagatgaa
gatggtccaaagcaatggacagacctccgttatgagcatgtaatgaagcttcgacaagtg
gctctggagtcagcccgtgagatgtgggcggactacttcatgttggcggactgtgataat
ctgctcaccaatcccgatgtgctctggaagatgatgaaagagaataagacgatcatcgca
ccaatgctggagtcacgtgcggcctattccaacttctggtgtggaatgacatcacagggt
tactataagcgcacacctgcctacatacctattaggaagcaggtgcgtaagggctgtttt
gctgtacccatggtccactccaccttcctgattgacctgaggaaagaggcgtccaaacag
ctagccttccacccaccacaccctgaatacacatgggcttttgatgatatcattgtgttt
gcttactctgctcagatggcagatgtccagatgtttgtttgtaacaaagagacctatgga
tacttgcctgcaccccttcgctcccacaatactttgcaagatgaagctgacagcttcttg
cacacagtgcttgaggttaatgtgcggaattccgcactgacgccttccaaacatgtacgt
gttcccagacgaaaacctgacaaaatgggatttgatgaggtatttatgataaacttacaa
aggcgaactgaccgcaaagaacgcatgttgaggactttgtaccagcaggagatcgcttgc
aaggttattgcagctgtggatggaaaagcaatgaacatcagtgaagtccaggccatgggc
atccacatgcttccaggatatagtgacccttatcatggtcgcccactgacaaaaggagag
ctgggatgtttcctttcacactataaaatctgggaagagattgtagaacggcaactacac
acctccctggtgatcgaggacgacctacgctttgaagtatttttcaaacgtcgcctgatg
aacttgatgtatgaggttgaagaagaaggactggactgggaccttatttatatcggtcgc
aagagaatgcaagtggaccatccagagaaagcagtacctaatgtgcacaacttggtggaa
gcagactattcatactggactctgggttacatgatatcgttacaaggagcagagaagctt
ctgaaagcagaacctctgaagagaattttaccggtggatgagtttcttcccatcatgtac
aacaaacaccccgtatctgattacatggaacagtttgaaaccagggacttgaaggcgttt
tctgctgagcctcttctggtctatccaacacactacactggtgatccaggctacatcagc
gacacggaaacctccacggtgtgggacaacgacaaagtccgaacagactgggacagagca
cgctcggggaaaacccaggagcaggctaaaataagtagtgaggcccagaactctgacgtc
cttcagtccccctggaacagtgcagctcgagacgagctatga

DBGET integrated database retrieval system